Property Summary

NCBI Gene PubMed Count 193
PubMed Score 875.59
PubTator Score 1364.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Measles 22 5.942 3.0
Atypical Hemolytic Uremic Syndrome 9 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hemolytic-Uremic Syndrome 30 0.0 4.0

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytic glioma 1.200 7.6e-03
atypical teratoid / rhabdoid tumor 2.200 1.7e-04
colon cancer 1.300 2.1e-02
dermatomyositis 1.100 2.5e-03
ependymoma 1.600 5.3e-03
Gaucher disease type 1 -1.500 1.1e-03
glioblastoma 1.400 3.4e-02
group 4 medulloblastoma 1.300 1.4e-02
hereditary spastic paraplegia -1.162 1.2e-02
interstitial cystitis -1.100 1.9e-03
interstitial lung disease -1.200 3.1e-02
intraductal papillary-mucinous adenoma (... 1.100 3.9e-03
intraductal papillary-mucinous carcinoma... 1.500 1.4e-05
intraductal papillary-mucinous neoplasm ... 1.600 2.2e-02
invasive ductal carcinoma 1.100 1.9e-02
lung adenocarcinoma 1.861 3.0e-07
malignant mesothelioma -1.500 3.2e-05
medulloblastoma, large-cell 2.000 1.4e-04
Multiple myeloma 1.697 7.6e-03
non-inflammatory breast cancer 1.200 2.3e-02
oligodendroglioma 1.400 6.4e-03
osteosarcoma 1.826 1.1e-04
ovarian cancer -1.800 2.0e-05
Pick disease -1.200 2.5e-04
primitive neuroectodermal tumor 1.200 3.5e-04
progressive supranuclear palsy -1.200 1.6e-02

Gene RIF (145)

AA Sequence

MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFY      1 - 70
IPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILY     71 - 140
CELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYC    141 - 210
GDNSVWSRAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNSTWDPPV    211 - 280
PKCLKVLPPSSTKPPALSHSVSTSSTTKSPASSASGPRPTYKPPVSNYPGYPKPEEGILDSLDVWVIAVI    281 - 350
VIAIVVGVAVICVVPYRYLQRRKKKGTYLTDETHREVKFTSL                                351 - 392
//

Text Mined References (197)

PMID Year Title