Property Summary

NCBI Gene PubMed Count 185
Grant Count 209
R01 Count 119
Funding $26,697,413.17
PubMed Score 849.01
PubTator Score 1364.83

Knowledge Summary

Patent

No data available

Expression

Gene

PDB

5FO8   1CKL   1HR4   2O39   3INB   3L89   3O8E  

Gene RIF (136)

PMID Text
26746193 CD46 controls both Th1 activation and regulation via a miR-150-dependent mechanism.
26084023 gene deficiency results in defective Th1 cell induction due to failure in metabolic reprogramming
26054645 This review summarizes our current knowledge of disease-associated mutations in this complement inhibitor(CD46).
25879158 Each mutant C3b bound MCP at reduced affinity, providing a molecular basis for its reduced cofactor activity in atypical hemolytic uremic syndrome.
25787182 Data show that CD28 antigen costimulation modulates CD46 antigen surface expression on activated T cells.
25733390 Functional characterization of two novel non-synonymous alterations in CD46 and a Q950H change in factor H found in atypical hemolytic uremic syndrome patients.
25725314 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25710174 It was not discover any association between A304V or other CD46 SNPs and preeclampsia.
25320329 HIV-1 Gag associates with CD46 weakly in HeLa cells
25294155 Results suggest a possible role for multidrug resistance genes ABCA10 and ABCA6 in follicular lymphoma survival and add to the evidence that genetic variation in CD46 and IL8 may have prognostic implications follicular lymphoma.
More...

AA Sequence

MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFY      1 - 70
IPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILY     71 - 140
CELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYC    141 - 210
GDNSVWSRAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNSTWDPPV    211 - 280
PKCLKVLPPSSTKPPALSHSVSTSSTTKSPASSASGPRPTYKPPVSNYPGYPKPEEGILDSLDVWVIAVI    281 - 350
VIAIVVGVAVICVVPYRYLQRRKKKGTYLTDETHREVKFTSL                                351 - 392
//

Text Mined References (189)

PMID Year Title
26746193 2016 CD46 Activation Regulates miR-150-Mediated Control of GLUT1 Expression and Cytokine Secretion in Human CD4+ T Cells.
26084023 2015 Complement Regulates Nutrient Influx and Metabolic Reprogramming during Th1 Cell Responses.
26054645 2015 Complement regulator CD46: genetic variants and disease associations.
25879158 2015 The molecular and structural bases for the association of complement C3 mutations with atypical hemolytic uremic syndrome.
25787182 2015 Monocyte:T-cell interaction regulates human T-cell activation through a CD28/CD46 crosstalk.
25733390 2015 Functional characterization of two novel non-synonymous alterations in CD46 and a Q950H change in factor H found in atypical hemolytic uremic syndrome patients.
25725314 2015 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25710174 2015 Genetic analysis of membrane cofactor protein (CD46) of the complement system in women with and without preeclamptic pregnancies.
25344690 2014 Common variants associated with general and MMR vaccine-related febrile seizures.
25294155 2014 A comprehensive evaluation of the role of genetic variation in follicular lymphoma survival.
More...