Property Summary

NCBI Gene PubMed Count 38
PubMed Score 410.57
PubTator Score 21.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Synonym

Accession P15516 Q16243 Q502Z1
Symbols HIS2
HTN2
HTN5

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (19)

PMID Text
26775844 These findings provide further evidence that histatin 3 may be involved in the regulation of cell proliferation, particularly during G1/S transition, via the ubiquitin-proteasome system of p27(Kip1) and HSC70.
26544073 Histatin 5 Salivary Complexes
24974109 High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase.
24951439 Hst 5 may affect mitochondrial functions and cause oxidative stress; however, the ultimate cause of cell death is by volume dysregulation and ion imbalance triggered by osmotic stress. [Review]
22033918 analysis of histatin 5 uptake by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins
21741339 Histatin-5 is a likely transport molecule for toxic Ni(II) in human saliva.Its binding constant to nickel is five time higher than that of albumin.
20487276 Hst 5 binding to beta-glucans on the cell wall of C. albicans is salt-sensitive. Uptake of Hst 5 shows dose-dependent translocation and intracellular accumulation precede vacuole expansion and propidium iodide uptake.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19753800 Gene polymorphism at codon 23 of the histatin 3 gene was not associated with periodontitis in the Japanese population. Rather it appeared to be associated with resistance to periodontitis.
19753800 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN                         1 - 51
//

Text Mined References (40)

PMID Year Title
26775844 2016 Salivary protein histatin 3 regulates cell proliferation by enhancing p27(Kip1) and heat shock cognate protein 70 ubiquitination.
26544073 2015 In Vitro Identification of Histatin 5 Salivary Complexes.
24974109 2014 The assessment of sIgA, histatin-5, and lactoperoxidase levels in saliva of adolescents with dental caries.
24951439 2014 How does it kill?: understanding the candidacidal mechanism of salivary histatin 5.
23499434 2013 Reversible redox regulation of specificity of Arg-gingipain B in Porphyromonas gingivalis.
22033918 2011 Histatin 5 uptake by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins.
21741339 2011 Salivary histatin-5, a physiologically relevant ligand for Ni(II) ions.
20973643 2010 Salivary peptidomics.
20487276 2010 Salivary histatin 5 internalization by translocation, but not endocytosis, is required for fungicidal activity in Candida albicans.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...