Property Summary

NCBI Gene PubMed Count 40
PubMed Score 435.81
PubTator Score 21.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (21)

AA Sequence

MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN                         1 - 51
//

Text Mined References (42)

PMID Year Title