Property Summary

NCBI Gene PubMed Count 38
Grant Count 39
R01 Count 20
Funding $4,916,686.16
PubMed Score 410.57
PubTator Score 21.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (19)

PMID Text
26775844 These findings provide further evidence that histatin 3 may be involved in the regulation of cell proliferation, particularly during G1/S transition, via the ubiquitin-proteasome system of p27(Kip1) and HSC70.
26544073 Histatin 5 Salivary Complexes
24974109 High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase.
24951439 Hst 5 may affect mitochondrial functions and cause oxidative stress; however, the ultimate cause of cell death is by volume dysregulation and ion imbalance triggered by osmotic stress. [Review]
22033918 analysis of histatin 5 uptake by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins
21741339 Histatin-5 is a likely transport molecule for toxic Ni(II) in human saliva.Its binding constant to nickel is five time higher than that of albumin.
20487276 Hst 5 binding to beta-glucans on the cell wall of C. albicans is salt-sensitive. Uptake of Hst 5 shows dose-dependent translocation and intracellular accumulation precede vacuole expansion and propidium iodide uptake.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19753800 Gene polymorphism at codon 23 of the histatin 3 gene was not associated with periodontitis in the Japanese population. Rather it appeared to be associated with resistance to periodontitis.
19753800 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN                         1 - 51
//

Text Mined References (40)

PMID Year Title
26775844 2016 Salivary protein histatin 3 regulates cell proliferation by enhancing p27(Kip1) and heat shock cognate protein 70 ubiquitination.
26544073 2015 In Vitro Identification of Histatin 5 Salivary Complexes.
24974109 2014 The assessment of sIgA, histatin-5, and lactoperoxidase levels in saliva of adolescents with dental caries.
24951439 2014 How does it kill?: understanding the candidacidal mechanism of salivary histatin 5.
23499434 2013 Reversible redox regulation of specificity of Arg-gingipain B in Porphyromonas gingivalis.
22033918 2011 Histatin 5 uptake by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins.
21741339 2011 Salivary histatin-5, a physiologically relevant ligand for Ni(II) ions.
20973643 2010 Salivary peptidomics.
20487276 2010 Salivary histatin 5 internalization by translocation, but not endocytosis, is required for fungicidal activity in Candida albicans.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...