Property Summary

NCBI Gene PubMed Count 145
PubMed Score 20.96
PubTator Score 302.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Synonym

Accession P15514 Q5U026 AR
Symbols AR
SDGF
AREGB
CRDGF

Gene

PANTHER Protein Class (2)

PDB

2RNL  

Gene RIF (113)

PMID Text
26527289 Our findings implicate amphiregulin as a critical mediator of the estrogen response in ERalpha-positive breast cancer
26503469 High Amphiregulin enhances intercellular adhesion molecule-1 expression and promotes tumor metastasis in osteosarcoma.
26451607 High expression of amphiregulin is associated with hepatocellular carcinoma.
26234682 results demonstrate that AREG controls G2/M progression and cytokinesis in keratinocytes via activation of a FoxM1-dependent transcriptional program, suggesting new avenues for treatment of epithelial cancer
26201903 Findings show the involvement of amphiregulin and semaphorin-3A in the improvement of skin innervations and penetration of nerve fibers into the epidermis.
26047642 Bradykinin (BK) stimulation of human airway smooth muscle cell increases amphiregulin secretion in a mechanism dependent on BK-induced COX-2 expression.
25911599 Altered AREG expression induced by diverse luteinizing hormone receptor reactivity in granulosa cells may provide a useful marker for oocyte developmental competency
25869072 This study shows that TGF-alpha uses common and divergent molecular mediators to regulate E-cadherin expression and cell invasion.
25862847 The applied drugs showed remarkable suppression of mTOR expression, which might delay tumor progression. Interestingly, sorafenib and sunitinib increased AREG in HNSCC 11A and 14C
25825984 Amphiregulin enhances alpha6beta1 integrin expression and cell motility in human chondrosarcoma cells through Ras/Raf/MEK/ERK/AP-1 pathway.
More...

AA Sequence

MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMP      1 - 70
SSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR     71 - 140
KKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSA    141 - 210
VILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA                                211 - 252
//

Text Mined References (148)

PMID Year Title
26527289 2015 Amphiregulin Is a Critical Downstream Effector of Estrogen Signaling in ER?-Positive Breast Cancer.
26503469 2015 Amphiregulin enhances intercellular adhesion molecule-1 expression and promotes tumor metastasis in human osteosarcoma.
26451607 2015 Amphiregulin activates regulatory T lymphocytes and suppresses CD8+ T cell-mediated anti-tumor response in hepatocellular carcinoma cells.
26234682 2016 The EGF receptor ligand amphiregulin controls cell division via FoxM1.
26201903 2015 Expression of Neuropeptides, Neurotrophins, and Neurotransmitters in the Skin of Patients with Atopic Dermatitis and Psoriasis.
26047642 2015 Human airway smooth muscle cells secrete amphiregulin via bradykinin/COX-2/PGE2, inducing COX-2, CXCL8, and VEGF expression in airway epithelial cells.
25911599 2015 Altered amphiregulin expression induced by diverse luteinizing hormone receptor reactivity in granulosa cells affects IVF outcomes.
25869072 2015 Transforming growth factor-? induces human ovarian cancer cell invasion by down-regulating E-cadherin in a Snail-independent manner.
25862847 2015 Targeting mTOR and AREG with everolimus, sunitinib and sorafenib in HPV-positive and -negative SCC.
25825984 2015 Amphiregulin enhances alpha6beta1 integrin expression and cell motility in human chondrosarcoma cells through Ras/Raf/MEK/ERK/AP-1 pathway.
More...