Property Summary

NCBI Gene PubMed Count 156
PubMed Score 307.46
PubTator Score 302.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast cancer 3577 0.0 0.00532233652809818
Disease Target Count Z-score Confidence
Cancer 2499 4.944 2.5

Expression

  Differential Expression (32)

Disease log2 FC p
Breast cancer -1.900 5.3e-03
psoriasis 1.200 1.6e-03
acute quadriplegic myopathy 1.417 1.1e-05
aldosterone-producing adenoma -1.314 4.6e-02
atypical teratoid / rhabdoid tumor -1.200 6.2e-03
breast carcinoma -1.100 6.7e-04
chronic rhinosinusitis -2.494 4.3e-02
colon cancer 2.300 2.0e-02
cutaneous lupus erythematosus 2.500 6.2e-05
cystic fibrosis 2.100 8.1e-04
fibroadenoma 2.600 2.5e-02
gastric carcinoma 2.400 3.2e-02
head and neck cancer 1.500 2.1e-02
hepatocellular carcinoma -1.800 1.9e-02
interstitial cystitis 3.700 3.1e-03
intraductal papillary-mucinous adenoma (... 2.300 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.600 2.9e-02
lung adenocarcinoma -1.100 5.2e-04
lung cancer -2.200 4.8e-04
lung carcinoma -3.200 8.7e-15
malignant mesothelioma -3.000 9.7e-09
medulloblastoma -1.200 2.1e-02
mucosa-associated lymphoid tissue lympho... -2.591 2.3e-02
non-small cell lung cancer -2.038 2.2e-08
ovarian cancer 2.200 8.6e-03
pancreatic cancer 1.800 2.4e-04
pituitary cancer -3.300 2.3e-07
Rheumatoid arthritis 2.500 1.8e-02
spina bifida -2.644 4.1e-02
tuberculosis -2.000 1.0e-02
ulcerative colitis 2.100 4.8e-05
urothelial carcinoma -2.500 5.9e-03

 CSPA Cell Line (3)

Protein-protein Interaction (4)

Gene RIF (124)

AA Sequence

MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMP      1 - 70
SSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR     71 - 140
KKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSA    141 - 210
VILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA                                211 - 252
//

Text Mined References (159)

PMID Year Title