Property Summary

Ligand Count 1
NCBI Gene PubMed Count 63
PubMed Score 137.39
PubTator Score 147.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 3.5e-05
cutaneous lupus erythematosus 1.100 4.0e-03
glioblastoma 1.400 3.5e-02
interstitial cystitis 1.300 3.6e-02
lung cancer -1.300 4.0e-04
lung carcinoma -2.000 2.0e-27
malignant mesothelioma 3.500 3.8e-07
medulloblastoma, large-cell -1.100 3.4e-03
osteosarcoma -2.307 2.9e-04
psoriasis 1.300 2.6e-81
subependymal giant cell astrocytoma 1.283 1.0e-02
tuberculosis -1.100 1.3e-05

 CSPA Cell Line (4)

Protein-protein Interaction (2)

Gene RIF (30)

AA Sequence

MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVV      1 - 70
EPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWAR     71 - 140
GPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLL    141 - 210
DTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENR    211 - 280
YNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFL    281 - 350
RIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT                        351 - 400
//

Text Mined References (65)

PMID Year Title