Property Summary

NCBI Gene PubMed Count 62
Grant Count 23
R01 Count 15
Funding $1,660,319.34
PubMed Score 132.81
PubTator Score 147.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 4.900 0.000
cutaneous lupus erythematosus 1.200 0.014
osteosarcoma -2.307 0.000
glioblastoma 1.400 0.035
medulloblastoma, large-cell -1.100 0.003
tuberculosis and treatment for 6 months -1.600 0.000
lung cancer -1.300 0.000
interstitial cystitis 1.300 0.036
pilocytic astrocytoma 1.300 0.000
subependymal giant cell astrocytoma 1.813 0.005
lung carcinoma -2.000 0.000
psoriasis 1.300 0.000

Gene RIF (29)

PMID Text
25923510 regulatory molecule causative of aortic dissection and intramural haematoma
25425184 Our cohort broadens the spectrum of knowledge about the clinical variability and genotype-phenotype correlations of juvenile PAP, and illustrates the favorable outcome of WLL treatment in severely affected patients
24714374 A possible relationship between dysfunction of the granulocyte-macrophage colony stimulating factor receptor, mapping to the pseudoautosomal X-Y region, may exist in myelodysplastic patients with initially lymphocytic Sweet syndrome.
23933508 Studies indicate the action of GM-CSF can be inhibited by at least two approaches: inhibition by GM-CSF neutralising antibodies, or blockade of GM-CSF binding to its receptor by antibodies against the GM-CSF receptor alpha chain CSF2Ralpha.
23898208 HIV-1 Tat upregulates the expression of colony stimulating factor 2 receptor, alpha subunit (CSF2RA) in human primary T cells
22935703 This study reveals a novel functional role of clathrin-coated structure in GMR signaling and the oncogenesis of JAK2V617F.
22430742 The GM-CSF Ralpha were ubiquitously but not uniformly expressed in neurons throughout the brain and downregulation in brain in patient with alzheimenr disease.
21557945 Identify defective expression and function of CD116 as a distinguishing feature of IBD and implicate an associated defect in innate immune responses toward granulocyte-macrophage colony-stimulating factor.
21056082 67-kDa laminin receptor expression influenced the characteristics of leukemia cells toward an aggressive phenotype and increased the number of granulocyte-macrophage colony-stimulating factor receptors
20078425 Data show that Deletion of the Ig-like domain of GM-CSFRalpha abolished direct GM-CSF binding and decreased growth signalling in the presence of hbetac.
More...

AA Sequence

MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVV      1 - 70
EPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWAR     71 - 140
GPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLL    141 - 210
DTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENR    211 - 280
YNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFL    281 - 350
RIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT                        351 - 400
//

Text Mined References (64)

PMID Year Title
25923510 2015 Granulocyte macrophage colony-stimulating factor is required for aortic dissection/intramural haematoma.
25425184 2014 Characterization of CSF2RA mutation related juvenile pulmonary alveolar proteinosis.
25416956 2014 A proteome-scale map of the human interactome network.
24714374 2014 Initially lymphocytic Sweet's syndrome in male patients with myelodysplasia: a distinguished clinicopathological entity? Case report and systematic review of the literature.
23933508 2013 GM-CSF as a therapeutic target in inflammatory diseases.
22935703 2012 Identification of a novel function of the clathrin-coated structure at the plasma membrane in facilitating GM-CSF receptor-mediated activation of JAK2.
22430742 2012 Distribution of granulocyte-monocyte colony-stimulating factor and its receptor ?-subunit in the adult human brain with specific reference to Alzheimer's disease.
21557945 2011 Defective leukocyte GM-CSF receptor (CD116) expression and function in inflammatory bowel disease.
21056082 2011 High expression of 67-kDa laminin receptor relates to the proliferation of leukemia cells and increases expression of GM-CSF receptor.
20078425 2010 The Ig-like domain of human GM-CSF receptor alpha plays a critical role in cytokine binding and receptor activation.
More...