Property Summary

NCBI Gene PubMed Count 224
PubMed Score 2025.20
PubTator Score 4913.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 4.16673093960737E-13
Duchenne muscular dystrophy 602 3.53291967227424E-9
adult high grade glioma 2148 1.02471379688539E-5
cystic fibrosis 1670 2.43733960432719E-5
sonic hedgehog group medulloblastoma 1482 1.1706672610819E-4
glioblastoma 5572 1.81436523568928E-4
primary pancreatic ductal adenocarcinoma 1271 0.00308233218837317
medulloblastoma, large-cell 6234 0.0052192687808954
pilocytic astrocytoma 3086 0.00872889347604453
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0115240506772176
oligodendroglioma 2849 0.0128837839546635
astrocytic glioma 2241 0.0140276687722558
psoriasis 6685 0.014384293725027
Gaucher disease type 3 76 0.01461624290414
invasive ductal carcinoma 2950 0.0240912594924267
Disease Target Count Z-score Confidence
Supravalvular aortic stenosis 6 0.0 5.0
Disease Target Count
Cutis laxa, autosomal dominant, 1 1

Expression

Gene

ELN

  Ortholog (3)

Species Source
Rat OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (178)

PMID Text
26601954 Data suggest that MFAP4 (microfibrillar-associated protein 4) binds tropoelastin, fibrillin-1/2, and elastin cross-linking amino acid desmosine; MFAP4 co-localizes with fibrillin-1-positive fibers; MFAP4 actively promotes tropoelastin self-assembly.
26325592 Studies indicate that the low sequence complexity, phase behavior, and elastic properties make elastin-like polypeptides (ELPs) an interesting intrinsically disordered proteins (IDP).
26309238 Transcriptional and posttranscriptional mechanisms contribute to the dysregulation of elastin expression and elastogenesis in Schimke immuno-osseous dysplasia.
26074138 In asthma, MMP-1 and MMP-2 mediate IL-13-induced suppression of ELN expression in airway fibroblasts.
25935650 Neutrophil elastase degraded elastin fragments are increased in the serum of patients with idiopathic pulmonary fibrosis and lung cancer compared to controls.
25803692 elastin may be important for plaque stability
25794852 Current knowledge about elastin peptides relevant to cardiovascular pathologies to further delineate their potential application in cardiovascular disease. [Review]
25792650 Up-regulation of elastin and fibulin-5 mRNA levels in ICA were strongly correlated with family history of cardiovascular disease when compared to CCA
25775011 there may be significantly different associations in genetic variants of elastin between two angiographic phenotypes of polypoidal choroidal vasculopathy (the significant association of rs868005 with Type 2, but not with Type 1)
25604393 Data suggest that cross-linking involving desmosine and isodesmosine residues in human tropoelastin and bovine elastin contributes to long-term stability of these proteins.
More...

AA Sequence

MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGL      1 - 70
AGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGK     71 - 140
VPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKA    141 - 210
PKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGA    211 - 280
GVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAG    281 - 350
IPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGV    351 - 420
PGVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGAAGAGVLGGLVPGPQAAVPGVPGTGGVPGVGTPAAAA    421 - 490
AKAAAKAAQFGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAAAAKSA    491 - 560
AKVAAKAQLRAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAGADEGVRRSLSPELREGDP    561 - 630
SSSQHLPSTPSSPRVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQ    631 - 700
FGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPI    701 - 770
FPGGACLGKACGRKRK                                                          771 - 786
//

Text Mined References (224)

PMID Year Title
26601954 2016 Characterization of Microfibrillar-associated Protein 4 (MFAP4) as a Tropoelastin- and Fibrillin-binding Protein Involved in Elastic Fiber Formation.
26325592 2015 Elastin-like polypeptides as models of intrinsically disordered proteins.
26309238 2015 Transcriptional and posttranscriptional mechanisms contribute to the dysregulation of elastogenesis in Schimke immuno-osseous dysplasia.
26074138 2016 Role of Matrix Metalloproteinases-1 and -2 in Interleukin-13-Suppressed Elastin in Airway Fibroblasts in Asthma.
25935650 2015 Serological assessment of neutrophil elastase activity on elastin during lung ECM remodeling.
25803692 2015 Low elastin content of carotid plaques is associated with increased risk of ipsilateral stroke.
25794852 2015 Soluble elastin peptides in cardiovascular homeostasis: Foe or ally.
25792650 Gene expression levels of elastin and fibulin-5 according to differences between carotid plaque regions.
25775011 2015 The association of elastin gene variants with two angiographic subtypes of polypoidal choroidal vasculopathy.
25604393 2015 Fingerprinting desmosine-containing elastin peptides.
More...