Property Summary

Ligand Count 1
NCBI Gene PubMed Count 183
PubMed Score 489.11
PubTator Score 296.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 2.5e-03
interstitial cystitis 1.400 2.8e-03
osteosarcoma -3.905 7.0e-08
spina bifida 1.036 4.2e-02
subependymal giant cell astrocytoma 1.266 2.0e-02

Gene RIF (112)

AA Sequence

MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREVNLRPQMSQFL      1 - 70
CLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNRGIMPFPTEEESVGDED     71 - 140
IYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYT    141 - 210
DTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVY    211 - 280
GRYCSQVESASKHLDRVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEA    281 - 350
MEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM    351 - 420
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGYELFFKTRE    421 - 490
LKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGR    491 - 560
VPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKA    561 - 630
EAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVK    631 - 700
DAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEK    701 - 770
RTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED    771 - 840
YSEYC                                                                     841 - 845
//

Text Mined References (188)

PMID Year Title