Property Summary

NCBI Gene PubMed Count 177
Grant Count 346
R01 Count 236
Funding $31,001,569.15
PubMed Score 465.90
PubTator Score 296.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 0.002
osteosarcoma -3.905 0.000
interstitial cystitis 1.400 0.003
subependymal giant cell astrocytoma 1.266 0.020
spina bifida 1.036 0.042

Synonym

Accession P15498 B4DVK9 M0QXX6 Q15860
Symbols VAV

Gene

PDB

2CRH   2LCT   2MC1   2ROR   3BJI   3KY9  

Gene RIF (112)

PMID Text
26043137 revealed a new function for Vav1 in the negative feedback regulation of the phosphorylation of immunoreceptor tyrosine-based activation motifs within the zeta chains, CD3 delta, epsilon, gamma chains, as well as activation sites on the critical T cell tyrosine kinases
25539813 our data provide evidence that Vav1 is the linker molecule that couples CD28 to PIP5Kalpha activation and strongly fit with a potential model in which CD28 regulates PIP2 synthesis and turnover in T lymphocytes.
25531316 These findings establish VAV1 as a critical epigenetically regulated oncogene with a key role in MBSHH maintenance, and highlight its potential as a validated therapeutic target and prognostic biomarker for the improved therapy of medulloblastoma.
25426554 Data indicate that only a single mutation in the proto-oncogene Vav1 enhances tumorigenicity.
25313137 results presented herein suggest a potential cross-talk between cancer cells and the microenvironment controlled by CSF1/Vav1 signaling pathways.
24905577 The present study implies that estrogen-estrogen receptor modulates the transcription and expression of Vav1, which may contribute to the proliferation of cancerous cells.
24880064 The role of Vav1 in T leukemia survival by selectively triggering Rac2-Akt axis and elevating the expression of anti-apoptotic Bcl-2.
24332539 suggest that Vav1 promotes the matrix-degrading processes underlying tumor cell migration and further, under conditions of ectopic Vav1 expression, that Vav1 is a central regulator and major driver of invasive matrix remodeling by pancreatic tumor cells
23986795 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
23856093 VAV1 overexpression in both SKOV3 and human ovarian surface epithelial cells demonstrated that its upregulation of an E-cadherin transcriptional repressor, Snail and Slug, was not confined to ovarian cancer cells
More...

AA Sequence

MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREVNLRPQMSQFL      1 - 70
CLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNRGIMPFPTEEESVGDED     71 - 140
IYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYT    141 - 210
DTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVY    211 - 280
GRYCSQVESASKHLDRVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEA    281 - 350
MEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM    351 - 420
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGYELFFKTRE    421 - 490
LKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGR    491 - 560
VPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKA    561 - 630
EAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVK    631 - 700
DAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEK    701 - 770
RTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED    771 - 840
YSEYC                                                                     841 - 845
//

Text Mined References (182)

PMID Year Title
26043137 2015 Vav1 Regulates T-Cell Activation through a Feedback Mechanism and Crosstalk between the T-Cell Receptor and CD28.
25539813 2015 Phosphatidylinositol 4-phosphate 5-kinase ? and Vav1 mutual cooperation in CD28-mediated actin remodeling and signaling functions.
25531316 2015 Cross-species epigenetics identifies a critical role for VAV1 in SHH subgroup medulloblastoma maintenance.
25426554 2015 Mutation of Vav1 adaptor region reveals a new oncogenic activation.
25313137 2014 Vav1 promotes lung cancer growth by instigating tumor-microenvironment cross-talk via growth factor secretion.
24905577 2014 Estrogen induces Vav1 expression in human breast cancer cells.
24880064 2014 Vav1 increases Bcl-2 expression by selective activation of Rac2-Akt in leukemia T cells.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24332539 2014 Vav1 as a central regulator of invadopodia assembly.
23856093 2013 VAV1 represses E-cadherin expression through the transactivation of Snail and Slug: a potential mechanism for aberrant epithelial to mesenchymal transition in human epithelial ovarian cancer.
More...