Property Summary

Ligand Count 166
NCBI Gene PubMed Count 107
PubMed Score 191.02
PubTator Score 220.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (30)

Disease log2 FC p
aldosterone-producing adenoma -1.912 3.6e-02
astrocytic glioma -1.100 8.8e-03
Atopic dermatitis -2.000 2.7e-04
chronic rhinosinusitis -1.786 1.1e-02
colon cancer -1.700 1.4e-02
cystic fibrosis -1.100 1.4e-02
glioblastoma -1.100 1.9e-05
head and neck cancer -1.400 5.0e-02
interstitial cystitis -2.100 3.2e-02
intraductal papillary-mucinous adenoma (... 2.300 1.8e-02
intraductal papillary-mucinous carcinoma... 1.100 2.0e-02
intraductal papillary-mucinous neoplasm ... 2.700 6.8e-03
lung adenocarcinoma -2.300 4.7e-09
lung cancer -2.000 6.1e-03
lung carcinoma -5.000 1.4e-31
medulloblastoma -1.100 9.0e-03
non-small cell lung cancer -2.911 1.6e-19
oligodendroglioma -1.200 3.4e-03
osteosarcoma -1.352 2.8e-02
ovarian cancer -1.400 2.1e-03
pancreatic cancer 2.000 7.1e-04
pancreatic ductal adenocarcinoma liver m... -3.270 3.3e-03
pediatric high grade glioma -1.100 6.4e-03
periodontitis -1.100 1.2e-15
primitive neuroectodermal tumor -1.300 1.6e-02
psoriasis -1.400 2.4e-04
Rheumatoid arthritis 1.200 1.2e-02
spina bifida -2.207 4.1e-02
tuberculosis and treatment for 3 months -1.100 1.2e-03
ulcerative colitis -1.700 9.0e-05

Gene RIF (86)

AA Sequence

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQ      1 - 70
LRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLA     71 - 140
GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHI    141 - 210
KDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ                  211 - 266
//

Text Mined References (110)

PMID Year Title