Property Summary

NCBI Gene PubMed Count 103
PubMed Score 176.63
PubTator Score 220.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 1.35350137390664E-31
non-small cell lung cancer 2798 2.84875820607612E-23
periodontitis 269 1.21981088383659E-15
lung adenocarcinoma 2714 4.690416629899E-9
ovarian cancer 8492 3.85037403483301E-7
lung cancer 4473 5.58041624172194E-6
ulcerative colitis 2087 6.0556082900956E-5
psoriasis 6685 9.55270742894926E-5
Atopic dermatitis 944 2.74138282229502E-4
glioblastoma 5572 3.50600520852547E-4
pancreatic cancer 2300 7.13189012153374E-4
tuberculosis and treatment for 3 months 327 7.58556257668066E-4
pediatric high grade glioma 2712 9.59523120826022E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0013699550310467
oligodendroglioma 2849 0.00341314576601893
osteosarcoma 7933 0.00643577620479421
chronic rhinosinusitis 512 0.00692384912319536
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00850914474904122
astrocytic glioma 2241 0.00879279311341037
medulloblastoma 1524 0.00895093617129614
Rheumatoid Arthritis 1171 0.0122057732623777
head and neck cancer 270 0.0140580478135951
primitive neuroectodermal tumor 3031 0.0164895916950727
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0200862197159868
interstitial cystitis 2299 0.0209234294322132
colon cancer 1475 0.0218446147927136
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0295565308872631
aldosterone-producing adenoma 664 0.0362885746018741
spina bifida 1064 0.0409323319619009
cystic fibrosis and chronic rhinosinusitis 213 0.0436136771441768

Expression

Synonym

Accession P15428 B4DTA4 B4DU74 B4DV57 D3DP43 E7EV11 O00749 Q06F08 Q12998 15-PGDH
Symbols PGDH
PGDH1
PHOAR1
15-PGDH
SDR36C1

Gene

PANTHER Protein Class (2)

PDB

2GDZ  

  Ortholog (12)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
894 confirmatory 6496 / 17572 / 126771 qHTS Assay for Inhibitors of HPGD (15-Hydroxyprostaglandin Dehydrogenase)
2407 summary 3 / 0 / 0 Probe Development Summary for Inhibitors of HPGD (15-Hydroxyprostaglandin Dehydrogenase)
2427 confirmatory 22 / 18 / 2 Thermal Shift Assay for Inhibitors of HPGD (15-Hydroxyprostaglandin Dehydrogenase)
2429 confirmatory 78 / 4 / 7 Confirmation qHTS Assay for Inhibitors of HPGD (15-Hydroxyprostaglandin Dehydrogenase)
504606 other 1 / 0 / 2 Inhibitors of HPGD: Aqueous Solubility Profiling
504638 other 0 / 0 / 2 Inhibitors of HPGD: Mouse Liver Microsome Profiling
743196 summary 0 / 0 / 0 Extended Characterization of HPGD Inhibitors: Summary

Gene RIF (82)

PMID Text
26287481 15-PGDH mRNA levels were significantly higher in aorta samples from patients undergoing abdominal aortic aneurysm repair than in those from healthy multiorgan donors.
26261578 Neoadjuvant chemotherapy could increase 15-PGDH expression in advanced gastric cancer patients, and 15-PGDH may serve as a candidate prognostic biomarker of advanced GC response to therapy.
26135126 A common mutation and a novel mutation in HPGD gene were identified to be responsible for primary hypertrophic osteoarthropathy
26093984 Peroxisome proliferator-activated receptors (PPARs) play pivotal roles in maintenance of Chorionic NAD-dependent 15-hydroxy prostaglandin dehydrogenase (PGDH) expression in chorion during human pregnancy.
26068857 Tissues from 15-PGDH knockout mice demonstrate similar increased regenerative capacity.
25863089 Hypertrophic osteoarthropathy in the Chinese family is caused by a homozygous mutation (c.310_311delCT) in the HPGD gene.
25773924 these findings suggest that 15 d-PGJ2 induces the expression of 15-PGDH through ROS-mediated activation of ERK1/2 and subsequently Elk-1 in the MDA-MB-231 cells
25735395 Loss of PGDH expression is associated with esophageal squamous cell carcinoma and adenocarcinoma.
25691459 Omega-3 polyunsaturated fatty acids upregulate the expression of 15-PGDH by inhibiting miR-26a and miR-26b.
25586183 Data show that hydroxylated Omega-3 fatty acid species are conferred with cell signaling capabilities after oxidation by 15-Hydroxyprostaglandin dehydrogenase (15PGDH).
More...

AA Sequence

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQ      1 - 70
LRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLA     71 - 140
GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHI    141 - 210
KDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ                  211 - 266
//

Text Mined References (106)

PMID Year Title
26287481 2015 Expression and Cellular Localization of 15-Hydroxy-Prostaglandin-Dehydrogenase in Abdominal Aortic Aneurysm.
26261578 2015 15-PGDH expression as a predictive factor response to neoadjuvant chemotherapy in advanced gastric cancer.
26135126 2015 A Common Mutation and a Novel Mutation in the HPGD Gene in Nine Patients with Primary Hypertrophic Osteoarthropathy.
26093984 2015 Expression of 15-Hydroxyprostaglandin Dehydrogenase in Human Chorion Is Associated with Peroxisome Proliferator-Activated Receptor Isoform Expression in Term Labor.
26068857 2015 TISSUE REGENERATION. Inhibition of the prostaglandin-degrading enzyme 15-PGDH potentiates tissue regeneration.
25863089 2015 [Genetic diagnosis for a Chinese Han family with primary hypertrophic osteoarthropathy].
25773924 2014 15-Deoxy-?12,14-prostaglandin J2 induces expression of 15-hydroxyprostaglandin dehydrogenase through Elk-1 activation in human breast cancer MDA-MB-231 cells.
25735395 2015 Expression of PGDH correlates with cell growth in both esophageal squamous cell carcinoma and adenocarcinoma.
25691459 2015 Omega-3 Polyunsaturated Fatty Acids Upregulate 15-PGDH Expression in Cholangiocarcinoma Cells by Inhibiting miR-26a/b Expression.
25586183 2015 15-Hydroxyprostaglandin dehydrogenase generation of electrophilic lipid signaling mediators from hydroxy ?-3 fatty acids.
More...