Property Summary

NCBI Gene PubMed Count 12
Grant Count 138
R01 Count 68
Funding $23,717,337.64
PubMed Score 607.15
PubTator Score 37.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -4.823 0.000
medulloblastoma, large-cell -1.200 0.002
lung adenocarcinoma -1.600 0.000
non-small cell lung carcinoma -1.200 0.000

Synonym

Accession P15421 D3DNZ5
Symbols GPE
MNS
MiIX

Gene

AA Sequence

MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIFEVMLVVVGMI      1 - 70
ILISYCIR                                                                   71 - 78
//

Text Mined References (12)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12949139 2003 Rapidly evolving genes in human. I. The glycophorins and their possible role in evading malaria parasites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10862083 2000 A novel St(a) glycophorin produced via gene conversion of pseudoexon III from glycophorin E to glycophorin A gene.
7798177 1994 Characterization of glycophorin A transcripts: control by the common erythroid-specific promoter and alternative usage of different polyadenylation signals.
7622054 1995 Detailed physical mapping of the genes encoding glycophorins A, B and E, as revealed by P1 plasmids containing human genomic DNA.
7521873 1994 Contribution of gene conversion to the retention of the sequence for M blood group type determinant in glycophorin E gene.
2390989 1990 A novel gene member of the human glycophorin A and B gene family. Molecular cloning and expression.
2295603 1990 Identification of a novel human glycophorin, glycophorin E, by isolation of genomic clones and complementary DNA clones utilizing polymerase chain reaction.
2249783 1990 Promoter sequence and chromosomal organization of the genes encoding glycophorins A, B and E.
More...