Property Summary

NCBI Gene PubMed Count 12
PubMed Score 636.01
PubTator Score 37.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.400 1.1e-12
medulloblastoma, large-cell -1.200 1.7e-03
non-small cell lung carcinoma -1.200 5.5e-29
osteosarcoma -4.823 2.6e-11

AA Sequence

MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIFEVMLVVVGMI      1 - 70
ILISYCIR                                                                   71 - 78
//

Text Mined References (12)

PMID Year Title