Property Summary

NCBI Gene PubMed Count 40
PubMed Score 120.72
PubTator Score 59.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Type 1 diabetes mellitus 104 0.0 1.0
Disease Target Count Z-score Confidence
Systemic scleroderma 66 3.456 1.7
Cancer 2346 3.257 1.6

Expression

  Differential Expression (34)

Disease log2 FC p
glioblastoma -2.100 6.4e-05
gastric cancer -1.600 1.1e-02
hepatocellular carcinoma -1.600 2.6e-05
pancreatic cancer 2.200 2.2e-04
malignant mesothelioma -1.300 1.1e-06
astrocytic glioma -2.100 1.9e-02
oligodendroglioma -2.400 6.5e-03
osteosarcoma 2.304 6.5e-03
chronic lymphosyte leukemia -1.100 9.3e-09
posterior fossa group B ependymoma -1.900 1.1e-04
non diabetic and post-ischemic heart fai... -1.100 3.9e-03
atypical teratoid / rhabdoid tumor -2.100 4.0e-04
medulloblastoma -1.500 4.9e-03
medulloblastoma, large-cell -3.100 3.3e-05
primitive neuroectodermal tumor -2.800 1.1e-04
acute quadriplegic myopathy 2.766 1.1e-11
juvenile dermatomyositis 1.067 1.5e-10
adrenocortical carcinoma -1.725 2.3e-04
primary pancreatic ductal adenocarcinoma 2.174 6.5e-04
tuberculosis -2.600 7.0e-07
intraductal papillary-mucinous adenoma (... 1.600 2.0e-03
intraductal papillary-mucinous carcinoma... 1.300 4.6e-03
lung cancer -3.500 1.0e-04
interstitial cystitis -1.200 1.5e-03
pediatric high grade glioma -1.300 9.8e-03
pilocytic astrocytoma -1.100 3.5e-02
pancreatic carcinoma -1.100 2.4e-03
aldosterone-producing adenoma -1.387 4.6e-02
psoriasis -1.200 1.1e-05
lung carcinoma -1.800 7.7e-13
spina bifida -2.083 4.3e-02
ovarian cancer 2.800 1.0e-05
pituitary cancer -3.900 3.7e-06
chronic rhinosinusitis -1.342 2.8e-02

Gene RIF (18)

PMID Text
26581505 The binding and expression of c-Fos/Fra-2 increased as a function of severity of tongue lesions, yet selective participation of c-Jun appears to promote poor differentiation and aggressive tumorigenesis.
25375657 FOSL2 facilitates TGF-beta1-induced migration by interaction with Smad3 in non-small cell lung cancer.FOSL2 positively regulates TGF-beta1 signalling .
24587342 FRA2 is a STAT5 target gene regulated by IL-2 in human CD4 T cells.
23482931 SOX4 is a direct target gene of FRA-2 and induces expression of HDAC8 in adult T-cell leukemia/lymphoma.
23339184 we show that the suppression was mediated, at least in part, by a suspension culture-driven decrease in the levels of two members of the AP1 transcription factor complex, c-Jun and Fra2
22523431 This study suggests that Fra-2 transgenic mice as an animal model of systemic sclerosis-associated pulmonary arterial hypertension display main characteristic features of the human disease.
22493372 results demonstrate the presence of a common oncogenic cascade initiated by FRA2/JUND in CCR4-expressing mature T-cell malignancies such as ATLL and CTCLs
22326952 FOSL2 is a critical regulator of leptin expression in adipocytes
20837772 These findings reveal a novel function of Fra-2/AP-1 as a positive regulator of bone and matrix formation in mice and humans.
20675274 Results suggest that Fra-2 protein may be more effective than ATF-2 protein in cyst formation originated from epithelial cells of dental follicles.
20039427 Fra-2 is overexpressed in SSc and acts as a novel downstream mediator of the profibrotic effects of TGFbeta and PDGF.
19933934 Fra-2 is present in human systemic sclerosis and may contribute to the development of microvasculopathy by inducing endothelial cell apoptosis and by reducing endothelial cell migration and chemotaxis.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19620306 Fra-2 transgenic natural killer (NK)T cells produce unusually high amounts of interleukin (IL)-2 and IL-4, and proliferate abnormally.
19321746 Genes for Fra2, Id2, and CSF1-receptor are deregulated, regardless of whether the in anaplastic large cell lymphoma contains the t(2;5).
18641127 FRA2 and AP1 have roles in development of pulmonary fibrosis
18071306 aberrantly expressed Fra-2 in association with JunD may play a major role in CCR4 expression and oncogenesis in adult T-cell leukemia.
17393299 Fra-2 overexpression is associated with a more aggressive tumor phenotype and is probably involved in breast cancer progression in vivo.

AA Sequence

MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVIT      1 - 70
SMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAK     71 - 140
CRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMR    141 - 210
SGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNL    211 - 280
VFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL                            281 - 326
//

Text Mined References (51)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26581505 2015 Selective participation of c-Jun with Fra-2/c-Fos promotes aggressive tumor phenotypes and poor prognosis in tongue cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25375657 2014 FOSL2 positively regulates TGF-?1 signalling in non-small cell lung cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24587342 2014 FRA2 is a STAT5 target gene regulated by IL-2 in human CD4 T cells.
23482931 2013 SOX4 is a direct target gene of FRA-2 and induces expression of HDAC8 in adult T-cell leukemia/lymphoma.
23339184 2013 Microenvironmental regulation of BRCA1 gene expression by c-Jun and Fra2 in premalignant human ovarian surface epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22523431 2012 Fra-2 transgenic mice as a novel model of pulmonary hypertension associated with systemic sclerosis.
22493372 2012 Expression and function of FRA2/JUND in cutaneous T-cell lymphomas.
22326952 2012 FOSL2 promotes leptin gene expression in human and mouse adipocytes.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20837772 2010 Fra-2/AP-1 controls bone formation by regulating osteoblast differentiation and collagen production.
20675274 2010 Immunoreactivity of ATF-2 and Fra-2 in human dental follicle.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20039427 2010 The transcription factor Fra-2 regulates the production of extracellular matrix in systemic sclerosis.
19933934 2009 Transcription factor fos-related antigen-2 induces progressive peripheral vasculopathy in mice closely resembling human systemic sclerosis.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19620306 2009 Aberrant selection and function of invariant NKT cells in the absence of AP-1 transcription factor Fra-2.
19321746 2009 Gene deregulation and spatial genome reorganization near breakpoints prior to formation of translocations in anaplastic large cell lymphoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18641127 2008 Development of pulmonary fibrosis through a pathway involving the transcription factor Fra-2/AP-1.
18071306 2008 Aberrant expression of Fra-2 promotes CCR4 expression and cell proliferation in adult T-cell leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17393299 2008 Role of Fra-2 in breast cancer: influence on tumor cell invasion and motility.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14499865 2003 Hypertrophic agonists induce the binding of c-Fos to an AP-1 site in cardiac myocytes: implications for the expression of GLUT1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12052862 2002 Retinoic acid receptors inhibit AP1 activation by regulating extracellular signal-regulated kinase and CBP recruitment to an AP1-responsive promoter.
11708771 2001 Interaction of AP-1 with a cluster of NF-kappa B binding elements in the human TNF promoter region.
11570575 2001 Expression pattern of the AP-1 family in endometrial cancer: correlations with cell cycle regulators.
10816578 2000 Requirement of an AP-1 site in the calcium response region of the involucrin promoter.
10713367 2000 Interleukin-1beta induction of the chemokine RANTES promoter in the human astrocytoma line CH235 requires both constitutive and inducible transcription factors.
10419887 1999 Homocysteine-induced endoplasmic reticulum stress and growth arrest leads to specific changes in gene expression in human vascular endothelial cells.
8954781 1996 Chromosomal assignment of the human gene encoding the Fos-related antigen-2 (FRA2) to chromosome 2p22-p23.
2107490 1990 Isolation of human fos-related genes and their expression during monocyte-macrophage differentiation.