Property Summary

NCBI Gene PubMed Count 91
Grant Count 172
R01 Count 100
Funding $16,351,966.6
PubMed Score 214.26
PubTator Score 242.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.500 0.000

Synonym

Accession P15407 B4DR11 Q6FG51 FRA-1
Symbols FRA
FRA1
fra-1

Gene

PANTHER Protein Class (1)

Gene RIF (65)

PMID Text
26975631 SIRT1 expression correlated positively with Fra-1 expression, metastasis and overall survival in patients with colorectal cancer
26646695 Our results demonstrate that Fra-1 is an important determinant of the metastatic potential of human colon cancer cells, and that the Fra-1 classifier can be used as a prognostic predictor in colon cancer patients.
26549498 Results suggest that Fra-1 is upregulated in lung cancer tissues and functions by affecting the P53 signaling pathway.
26337460 miR-195 can repress the migration and invasion of prostate cancer cells via regulating Fra-1
26330014 We identified and confirmed that Fra-1 affected the expression level of CTTN and EZR in vitro through LC-MS/MS analyses and western blot technology.
25750173 Intense immunohistochemical staining of Fra-1 was observed at the tumor marginal area adjacent to inflammatory cells and in parallel with IL-6 secretion and STAT3 activation in colorectal cancer tissues.
25666264 High Fra-1 expression significantly correlates with shorter overall survival.
25651840 Results suggested that Fra-1 expression is low in cervical cancer tissues and promotes apoptosis of cervical cancer cells by p53 signaling pathway.
25301070 Fra-1 induces critical changes in the expression of tgfb1 and Epithelial-to-mesenchymal transition transcription factors through direct binding to the tgfb1, zeb1 and zeb2 genomic regulatory regions.
25175497 Fra1 promotes the growth of HaCaT cells in vitro by arresting the cell cycle and inhibiting cell apoptosis.
More...

AA Sequence

MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTY      1 - 70
PQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKL     71 - 140
EDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVL    141 - 210
EPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL             211 - 271
//

Text Mined References (94)

PMID Year Title
26975631 2016 SIRT1 promotes epithelial-mesenchymal transition and metastasis in colorectal cancer by regulating Fra-1 expression.
26646695 2015 Fra-1 is a key driver of colon cancer metastasis and a Fra-1 classifier predicts disease-free survival.
26549498 2016 Fra-1 is upregulated in lung cancer tissues and inhibits the apoptosis of lung cancer cells by the P53 signaling pathway.
26337460 2015 MicroRNA-195-5p, a new regulator of Fra-1, suppresses the migration and invasion of prostate cancer cells.
26330014 2015 Fra-1 is upregulated in gastric cancer tissues and affects the PI3K/Akt and p53 signaling pathway in gastric cancer.
25750173 2015 Aberrantly expressed Fra-1 by IL-6/STAT3 transactivation promotes colorectal cancer aggressiveness through epithelial-mesenchymal transition.
25666264 2015 Prognostic impact of transcription factor Fra-1 in ER-positive breast cancer: contribution to a metastatic phenotype through modulation of tumor cell adhesive properties.
25651840 2015 Fra-1 is downregulated in cervical cancer tissues and promotes cervical cancer cell apoptosis by p53 signaling pathway in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
25301070 2015 Fra-1/AP-1 induces EMT in mammary epithelial cells by modulating Zeb1/2 and TGF? expression.
More...