Property Summary

Ligand Count 1
NCBI Gene PubMed Count 109
PubMed Score 3206.23
PubTator Score 2076.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Agammaglobulinemia 34 5.185 2.6
Common variable immunodeficiency 101 0.0 5.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial cystitis 3.300 8.2e-04
nasopharyngeal carcinoma -1.400 2.8e-03
osteosarcoma -2.127 3.3e-05
periodontitis 1.300 3.7e-27
primary Sjogren syndrome 1.200 1.0e-03
tuberculosis and treatment for 3 months 1.100 2.1e-02
ulcerative colitis 1.900 5.5e-03

Protein-protein Interaction (7)

Gene RIF (78)

AA Sequence

MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPG      1 - 70
LGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRS     71 - 140
SEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRG    141 - 210
PLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVL    211 - 280
WHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGN    281 - 350
VLSLPTPTSGLGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF    351 - 420
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLSPHGSAWDPSR    421 - 490
EATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR        491 - 556
//

Text Mined References (114)

PMID Year Title