Property Summary

NCBI Gene PubMed Count 103
Grant Count 635
R01 Count 300
Funding $107,322,916.91
PubMed Score 3029.78
PubTator Score 2076.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.127 0.000
periodontitis 1.300 0.000
tuberculosis and treatment for 3 months 1.100 0.021
interstitial cystitis 3.300 0.001
primary Sjogren syndrome 1.200 0.001
nasopharyngeal carcinoma -1.400 0.003
ulcerative colitis 1.900 0.005

Synonym

Accession P15391 A0N0P9 F5H635 Q96S68 Q9BRD6
Symbols B4
CVID3

Gene

Gene RIF (72)

PMID Text
26852663 The frequencies of CD19+CD24hiCD38hi B-regulatory lymphocyte were significantly increased in children with beta-thalassemia.
26478008 CD19 is required for TLR9-induced B-cell activation. Hence CD19/PI3K/AKT/BTK is an essential axis integrating BCRs and TLR9 signaling in human B cells.
26111452 We demonstrate that this motif plays a role in the maturation and recycling of CD19 but in a CD81-independent manner.
25979433 The synaptic recruitment of lipid rafts is dependent on CD19-PI3K module and cytoskeleton remodeling molecules.
25914477 High anti-EBV IgG levels in Crohn's disease are associated with 5-aminosalicylic acid treatment, tonsillectomy, and decrease of CD19(+) cells.
25883042 Studies indicate that anti-CD19 and anti-CD33 bispecific antibodies showed anticancer activity.
25739938 a CD45+/CD19 - cell population in bone marrow aspirates correlated with the clinical outcome of patients with mantle cell lymphoma.
25739915 We propose that CD81 enables the maturation of CD19 and its trafficking to the membrane by regulating the exit of CD19 from the ER to the pre-Golgi compartment
25591810 we outline our approach to nonviral gene transfer using the Sleeping Beauty system and the selective propagation of CD19-specific CAR(+) T cells on AaPCs
25573986 propose a multilayer model of plasma cell (PC) memory in which CD19(+) and CD19(-) PC represent dynamic and static components, respectively, permitting both adaptation and stability of humoral immune protection
More...

AA Sequence

MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPG      1 - 70
LGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRS     71 - 140
SEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRG    141 - 210
PLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVL    211 - 280
WHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGN    281 - 350
VLSLPTPTSGLGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF    351 - 420
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLSPHGSAWDPSR    421 - 490
EATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR        491 - 556
//

Text Mined References (108)

PMID Year Title
26852663 2016 Regulatory B cells (CD19(+)CD38(hi)CD24(hi)) in alloimmunized and non-alloimmunized children with ?-thalassemia major.
26478008 2016 CD19 controls Toll-like receptor 9 responses in human B cells.
26111452 2015 Role of an arginine-lysine rich motif in maturation and trafficking of CD19.
25979433 2015 The synaptic recruitment of lipid rafts is dependent on CD19-PI3K module and cytoskeleton remodeling molecules.
25914477 2015 Epstein-Barr virus is related with 5-aminosalicylic acid, tonsillectomy, and CD19(+) cells in Crohn's disease.
25883042 2015 Clinical overview of anti-CD19 BiTE(®) and ex vivo data from anti-CD33 BiTE(®) as examples for retargeting T cells in hematologic malignancies.
25739938 2015 A subset of CD45+/CD19 - cells in bone marrow may be associated with clinical outcomes of patients with mantle cell lymphoma.
25739915 2015 A mutation in the human tetraspanin CD81 gene is expressed as a truncated protein but does not enable CD19 maturation and cell surface expression.
25591810 2015 Manufacture of T cells using the Sleeping Beauty system to enforce expression of a CD19-specific chimeric antigen receptor.
25573986 2015 A unique population of IgG-expressing plasma cells lacking CD19 is enriched in human bone marrow.
More...