Property Summary

NCBI Gene PubMed Count 35
PubMed Score 117.52
PubTator Score 48.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count
Neoplasm Metastasis 138

Expression

Synonym

Accession P15374 B2R970 Q5TBK8 Q6IBE9 UCH-L3
Symbols UCH-L3

Gene

PANTHER Protein Class (3)

PDB

1UCH   1XD3  

  Ortholog (16)

Species Source
Chimp OMA Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

 GWAS Trait (1)

Gene RIF (11)

PMID Text
25369561 Using a series of engineered protein substrates, which are similar in size yet differ in secondary structure, we demonstrate that thermal stability is a key factor that significantly affects UCH-L3 hydrolysis.
25194810 UCH-L3 is a novel regulator of epithelial-mesenchymal transition and cell migration in prostate cancer cells.
22679485 Data identified of UCHL3 as an essential deubiquitinase in adipogenesis.
21762696 impaired UCH-L3 function may contribute to the accumulation of full length UBB(+1) in various pathologie
19636824 identification and the sequence-specific assignments for 186 out of the 218 UCH-L3 (230 less 12 prolines) backbone 15N and amide proton resonances
19476499 Untangling the folding mechanism of the 5(2)-knotted protein UCH-L3
19343046 Observational study of gene-disease association. (HuGE Navigator)
19154770 These results indicate that mono-Ub and Ub dimers may regulate the enzymatic functions of UCH-L1 and UCH-L3, respectively, in vivo.
19047059 Substrate filtering by the active site crossover loop in UCHL3 revealed by sortagging and gain-of-function mutations.
16402389 Upregulation of UCH-L3 is associated with Uterine Cervical Neoplasms
More...

AA Sequence

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE      1 - 70
EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLEN     71 - 140
YDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCK    141 - 210
KFMERDPDELRFNAIALSAA                                                      211 - 230
//

Text Mined References (43)

PMID Year Title
25369561 2014 Characterizing substrate selectivity of ubiquitin C-terminal hydrolase-L3 using engineered ?-linked ubiquitin substrates.
25194810 2014 Ubiquitin C-terminal hydrolase-L3 regulates EMT process and cancer metastasis in prostate cell lines.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23562823 2013 Genome-wide association study in a Chinese population with diabetic retinopathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22689415 2012 Profiling ubiquitin linkage specificities of deubiquitinating enzymes with branched ubiquitin isopeptide probes.
22679485 2012 A novel RNAi lethality rescue screen to identify regulators of adipogenesis.
22510564 2012 Chalcone-based small-molecule inhibitors attenuate malignant phenotype via targeting deubiquitinating enzymes.
22284438 2012 Contribution of active site glutamine to rate enhancement in ubiquitin C-terminal hydrolases.
More...