Property Summary

NCBI Gene PubMed Count 35
Grant Count 8
R01 Count 7
Funding $659,555.55
PubMed Score 117.52
PubTator Score 48.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Neoplasm Metastasis 138

Expression

Gene RIF (11)

PMID Text
25369561 Using a series of engineered protein substrates, which are similar in size yet differ in secondary structure, we demonstrate that thermal stability is a key factor that significantly affects UCH-L3 hydrolysis.
25194810 UCH-L3 is a novel regulator of epithelial-mesenchymal transition and cell migration in prostate cancer cells.
22679485 Data identified of UCHL3 as an essential deubiquitinase in adipogenesis.
21762696 impaired UCH-L3 function may contribute to the accumulation of full length UBB(+1) in various pathologie
19636824 identification and the sequence-specific assignments for 186 out of the 218 UCH-L3 (230 less 12 prolines) backbone 15N and amide proton resonances
19476499 Untangling the folding mechanism of the 5(2)-knotted protein UCH-L3
19343046 Observational study of gene-disease association. (HuGE Navigator)
19154770 These results indicate that mono-Ub and Ub dimers may regulate the enzymatic functions of UCH-L1 and UCH-L3, respectively, in vivo.
19047059 Substrate filtering by the active site crossover loop in UCHL3 revealed by sortagging and gain-of-function mutations.
16402389 Upregulation of UCH-L3 is associated with Uterine Cervical Neoplasms
More...

AA Sequence

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE      1 - 70
EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLEN     71 - 140
YDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCK    141 - 210
KFMERDPDELRFNAIALSAA                                                      211 - 230
//

Text Mined References (43)

PMID Year Title
25369561 2014 Characterizing substrate selectivity of ubiquitin C-terminal hydrolase-L3 using engineered ?-linked ubiquitin substrates.
25194810 2014 Ubiquitin C-terminal hydrolase-L3 regulates EMT process and cancer metastasis in prostate cell lines.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23562823 2013 Genome-wide association study in a Chinese population with diabetic retinopathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22689415 2012 Profiling ubiquitin linkage specificities of deubiquitinating enzymes with branched ubiquitin isopeptide probes.
22679485 2012 A novel RNAi lethality rescue screen to identify regulators of adipogenesis.
22510564 2012 Chalcone-based small-molecule inhibitors attenuate malignant phenotype via targeting deubiquitinating enzymes.
22284438 2012 Contribution of active site glutamine to rate enhancement in ubiquitin C-terminal hydrolases.
More...