Property Summary

NCBI Gene PubMed Count 166
PubMed Score 170.73
PubTator Score 301.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Neoplasms 63 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 3.33 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.4e-04
group 4 medulloblastoma 1.800 3.0e-04
medulloblastoma, large-cell 1.600 5.7e-07
osteosarcoma 1.227 1.8e-02
ovarian cancer -1.100 4.8e-04

Protein-protein Interaction (7)

Gene RIF (100)

AA Sequence

MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTP      1 - 70
TPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPH     71 - 140
PESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVP    141 - 210
VPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKA    211 - 280
ALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANED    281 - 350
PDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV    351 - 420
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALS    421 - 490
QIVMAPSSQSQPSGS                                                           491 - 505
//

Text Mined References (181)

PMID Year Title