Property Summary

NCBI Gene PubMed Count 155
Grant Count 181
R01 Count 146
Funding $11,664,485.33
PubMed Score 162.90
PubTator Score 301.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.240 0.001
group 4 medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
ovarian cancer -1.100 0.000

Gene

PANTHER Protein Class (1)

PDB

1BHI   1T2K   4H36  

Gene RIF (91)

PMID Text
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26645581 increased expression of the gene encoding PKCepsilon and abundance of phosphorylated, transcriptionally active ATF2 were observed in advanced-stage melanomas and correlated with decreased FUK expression
26462148 Results reveal that mitochondrial ATF2 is associated with the induction of apoptosis and BRAF inhibitor resistance through Bim activation.
26153406 Neisseria meningitidis caused a high level of E-selectin expression elicited by the activity of phosphorylated ATF2 transcription factor on the E-selectin promoter.
25961023 ATF2 mRNA is selectively retained in HIV-1 Nef-expressing cellular exosomes, and three miRNAs (miR-17, miR-92a, and miR-21) which target ATF2 mRNA are selectively secreted in exosomes from these cells
25456131 suppression of tumorigenesis by JNK requires ATF2.
25417007 More terminally differentiated human odontoblasts was ATF-2 positive, as compared to pulpal fibroblasts at various stages of differentiation: ATF-2 is more associated with cell survival rather than cell proliferation.
25258251 Study demonstrates the role of miR-622 in suppressing glioma invasion and migration mediated by ATF2, and shows that miR-622 expression inversely correlates with ATF2 in glioma patients
25141981 While expression of ATF-2 is not associated with outcome.
25096061 in human HCC tissues, SPTBN1 expression correlated negatively with expression levels of STAT3, ATF3, and CREB2; SMAD3 expression correlated negatively with STAT3 expression
More...

AA Sequence

MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTP      1 - 70
TPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPH     71 - 140
PESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVP    141 - 210
VPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKA    211 - 280
ALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANED    281 - 350
PDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV    351 - 420
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALS    421 - 490
QIVMAPSSQSQPSGS                                                           491 - 505
//

Publication (170)

PMID Year Title
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26645581 2015 The transcription factor ATF2 promotes melanoma metastasis by suppressing protein fucosylation.
26462148 2015 Mitochondrial ATF2 translocation contributes to apoptosis induction and BRAF inhibitor resistance in melanoma through the interaction of Bim with VDAC1.
26153406 2016 A critical role for ATF2 transcription factor in the regulation of E-selectin expression in response to non-endotoxin components of Neisseria meningitidis.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25456131 2014 JNK suppresses tumor formation via a gene-expression program mediated by ATF2.
25417007 2015 ATF-2 immunoreactivity in post-mitotic and terminally differentiated human odontoblasts.
25416956 2014 A proteome-scale map of the human interactome network.
25368329 2014 Human macrophage SCN5A activates an innate immune signaling pathway for antiviral host defense.
25258251 2015 MiR-622 suppresses proliferation, invasion and migration by directly targeting activating transcription factor 2 in glioma cells.
More...