Property Summary

NCBI Gene PubMed Count 112
Grant Count 26
R01 Count 20
Funding $3,834,719.92
PubMed Score 181.40
PubTator Score 194.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
Acute necrotizing encephalitis 1 4.115 2.1
Cancer 2,346 3.673 1.8
biotin-responsive basal ganglia disease 8 3.235 1.6
Acute lymphoid leukemia 25
Brain Diseases, Metabolic, Inborn 4
Burkitt's lymphoma 15
Carcinoma of female breast 20
Colonic Neoplasms 126
Congenital Abnormality 11
Congenital Heart Defects 37
Craniofacial Abnormalities 147
Endometriosis 535
Epilepsy 346
Gestational trophoblastic neoplasia 14
Intellectual disability 573
Juvenile rheumatoid arthritis 104
Malignant mesothelioma of pleura 7
Malignant tumor of head and/or neck 15
Malignant tumor of lung 5
Meningeal Leukemia 7
Movement Disorders 21
Mycosis fungoides 28
Neural Tube Defects 27
Neurodegeneration Due To Cerebral Folate... 1 
Neurodegenerative disease 383 4.0
Non-Hodgkin's lymphoma 22
Osteosarcoma of bone 6
Psychomotor Disorders 7
Rheumatoid Arthritis 1,160
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
cutaneous lupus erythematosus 1,056
diabetes mellitus 1,663
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non-inflammatory breast cancer 208
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
ovarian neoplasm 97
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
psoriasis 6,685

Expression

Gene RIF (85)

PMID Text
26617855 Suppression of FOLR1 by RNA interference altered gene expression profile of taxol-resistant nasopharyngeal carcinoma cells. Apoptosis-related genes, gene alterations in viral carcinogenesis/MAPK pathways may be important for taxol resistance reversal.
26606305 This new protocol opens an effective way through synthesis and design of novel fluorescent nano-conjugates for FR expression investigation in tumor cells via targeted imaging, showing great potential in drug delivery mechanism study and cancer therapy
26359629 Suggest RNA CAR T cell therapy for the treatment of common epithelial cancers expressing folate receptor-alpha.
26191275 Suggest that FRalpha overexpression may play a role in the endometrioid endometrium carcinoma carcinogenesis and carcinoma progression from endometrial hyperplasia.
26149693 Folate receptor expression on murine and human adipose tissue macrophages
26014017 The overexpression of folate receptor alpha mRNA was associated with growth of pituitary adenomas.
25971554 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers
25904506 Findings suggest the clinical development of IMGN853 as a novel targeted therapy for patients with folate receptor alpha (FRalpha)-expressing tumors.
25816016 triple negative/basal tumors were significantly associated with increased expression of FOLR1 mRNA, compared to ER+ and HER2+ tumors.
25697897 this is the first study to simultaneously evaluate both DNA methylation and protein expression of all three folate transporter genes, FOLR1, PCFT, and RFC1, in colorectal cancer.
More...

AA Sequence

MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNT      1 - 70
SQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCE     71 - 140
QWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCI    141 - 210
QMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS                           211 - 257
//

Text Mined References (116)

PMID Year Title
26617855 2015 Gene expression profiling of taxol-resistant nasopharyngeal carcinoma cells with siRNA-mediated FOLR1 downregulation.
26606305 2016 Folic acid-conjugated fluorescent polymer for up-regulation folate receptor expression study via targeted imaging of tumor cells.
26359629 2015 Rigorous optimization and validation of potent RNA CAR T cell therapy for the treatment of common epithelial cancers expressing folate receptor.
26191275 2015 Folate receptor ? expression and significance in endometrioid endometrium carcinoma and endometrial hyperplasia.
26149693 2015 Folate receptor expression on murine and human adipose tissue macrophages.
26014017 2015 Increase in folate receptor alpha expression in nonfunctional pituitary adenomas.
25971554 2015 Expression of folate receptors alpha and beta in normal and cancerous gynecologic tissues: correlation of expression of the beta isoform with macrophage markers.
25904506 2015 IMGN853, a Folate Receptor-? (FR?)-Targeting Antibody-Drug Conjugate, Exhibits Potent Targeted Antitumor Activity against FR?-Expressing Tumors.
25816016 2015 Folate receptor-? (FOLR1) expression and function in triple negative tumors.
25697897 2015 DNA methylation and expression of the folate transporter genes in colorectal cancer.
More...