Property Summary

NCBI Gene PubMed Count 112
PubMed Score 181.40
PubTator Score 194.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.89501468015713E-17
lung carcinoma 2844 3.00928477789694E-11
ovarian cancer 8492 3.0364556292461E-8
malignant mesothelioma 3163 3.34347406502931E-8
lung cancer 4473 1.37942916908609E-5
non-inflammatory breast cancer 208 1.054420703747E-4
adult high grade glioma 2148 1.1321916895047E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0010518385521437
diabetes mellitus 1663 0.00118905926297468
medulloblastoma, large-cell 6234 0.00125484468145708
atypical teratoid / rhabdoid tumor 4369 0.00144541439848567
glioblastoma 5572 0.00379384998985059
pituitary cancer 1972 0.00499299349099863
lung adenocarcinoma 2714 0.00611059861241521
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00928412467974608
invasive ductal carcinoma 2950 0.0102230451801132
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0146635857598037
Endometriosis 535 0.030246716337334
cutaneous lupus erythematosus 1056 0.0333645571050965
breast carcinoma 1614 0.0485115902683093
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0

Expression

Synonym

Accession P15328 Q53EW2 Q6FGT8 Q6LC90 Q9UCT2 FR-alpha
Symbols FBP
FOLR

Gene

PDB

4KM6   4KM7   4KMX   4LRH   5IZQ  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG
Pig OMA Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (85)

PMID Text
26617855 Suppression of FOLR1 by RNA interference altered gene expression profile of taxol-resistant nasopharyngeal carcinoma cells. Apoptosis-related genes, gene alterations in viral carcinogenesis/MAPK pathways may be important for taxol resistance reversal.
26606305 This new protocol opens an effective way through synthesis and design of novel fluorescent nano-conjugates for FR expression investigation in tumor cells via targeted imaging, showing great potential in drug delivery mechanism study and cancer therapy
26359629 Suggest RNA CAR T cell therapy for the treatment of common epithelial cancers expressing folate receptor-alpha.
26191275 Suggest that FRalpha overexpression may play a role in the endometrioid endometrium carcinoma carcinogenesis and carcinoma progression from endometrial hyperplasia.
26149693 Folate receptor expression on murine and human adipose tissue macrophages
26014017 The overexpression of folate receptor alpha mRNA was associated with growth of pituitary adenomas.
25971554 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers
25904506 Findings suggest the clinical development of IMGN853 as a novel targeted therapy for patients with folate receptor alpha (FRalpha)-expressing tumors.
25816016 triple negative/basal tumors were significantly associated with increased expression of FOLR1 mRNA, compared to ER+ and HER2+ tumors.
25697897 this is the first study to simultaneously evaluate both DNA methylation and protein expression of all three folate transporter genes, FOLR1, PCFT, and RFC1, in colorectal cancer.
More...

AA Sequence

MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNT      1 - 70
SQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCE     71 - 140
QWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCI    141 - 210
QMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS                           211 - 257
//

Text Mined References (116)

PMID Year Title
26617855 2015 Gene expression profiling of taxol-resistant nasopharyngeal carcinoma cells with siRNA-mediated FOLR1 downregulation.
26606305 2016 Folic acid-conjugated fluorescent polymer for up-regulation folate receptor expression study via targeted imaging of tumor cells.
26359629 2015 Rigorous optimization and validation of potent RNA CAR T cell therapy for the treatment of common epithelial cancers expressing folate receptor.
26191275 2015 Folate receptor ? expression and significance in endometrioid endometrium carcinoma and endometrial hyperplasia.
26149693 2015 Folate receptor expression on murine and human adipose tissue macrophages.
26014017 2015 Increase in folate receptor alpha expression in nonfunctional pituitary adenomas.
25971554 2015 Expression of folate receptors alpha and beta in normal and cancerous gynecologic tissues: correlation of expression of the beta isoform with macrophage markers.
25904506 2015 IMGN853, a Folate Receptor-? (FR?)-Targeting Antibody-Drug Conjugate, Exhibits Potent Targeted Antitumor Activity against FR?-Expressing Tumors.
25816016 2015 Folate receptor-? (FOLR1) expression and function in triple negative tumors.
25697897 2015 DNA methylation and expression of the folate transporter genes in colorectal cancer.
More...