Property Summary

NCBI Gene PubMed Count 386
Grant Count 507
R01 Count 324
Funding $64,972,495.82
PubMed Score 942.22
PubTator Score 511.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P15311 E1P5A8 P23714 Q4VX75 Q96CU8 Q9NSJ4
Symbols CVL
CVIL
VIL2
HEL-S-105

Gene

EZR

PDB

1NI2   4RM8   4RM9   4RMA  

Gene RIF (307)

PMID Text
26927385 Data show that both Ezrin and SIX1 proteins are highly expressed in alpha fetoprotein-negative hepatocellular carcinoma (HCC) and significantly related with the TNM stage.
26555866 Phospho-Ezrin/Radixin/Moesin (ERM) inhibit cell adhesion, and therefore, dephosphorylation of ERM proteins is essential for cell adhesion.Phospho-ERM induce formation and/or maintenance of spherical cell shape.
26419932 it was found that expression of miR-96 was negatively correlated with the metastatic ability of renal cell carcinoma, and that downregulation of miR-96 could suppress the invasion of renal cancer cell via downregulation of Ezrin expression.
26360636 HIV-1 MA interacts with EZR
26360636 siRNA knockdown of EZR enhances HIV-1 replication; HIV-1 replication is restricted by EZR
26358752 Data indicate that a quinoline-based small molecule, NSC305787, directly binds to ezrin and inhibits its functions.
26330014 We identified and confirmed that Fra-1 affected the expression level of CTTN and EZR in vitro through LC-MS/MS analyses and western blot technology.
26212029 Activation of liver PKCs during cholestasis leads to Ezrin Thr567 phosphorylation resulting in MRP2 internalization and degradation where ubiquitin ligase E3 GP78 is involved.
26209696 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26149384 ezrin controls the translation of mRNAs preferentially with a structured 5' untranslated region, at least in part, by sustaining the protein level of DDX3 and/or regulating its function.
More...

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV      1 - 70
RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE     71 - 140
VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN    141 - 210
KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI    211 - 280
LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR    281 - 350
LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE    351 - 420
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ    421 - 490
DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ    491 - 560
GRDKYKTLRQIRQGNTKQRIDEFEAL                                                561 - 586
//

Text Mined References (393)

PMID Year Title
26927385 2016 [Clinicopathological significance of ezrin and SIX1 protein expression in alpha fetoprotein-negative hepatocellular carcinoma].
26555866 2015 Inhibition of cell adhesion by phosphorylated Ezrin/Radixin/Moesin.
26419932 2015 miR-96 suppresses renal cell carcinoma invasion via downregulation of Ezrin expression.
26358752 2015 Identification of Novel Ezrin Inhibitors Targeting Metastatic Osteosarcoma by Screening Open Access Malaria Box.
26330014 2015 Fra-1 is upregulated in gastric cancer tissues and affects the PI3K/Akt and p53 signaling pathway in gastric cancer.
26212029 2015 Canalicular membrane MRP2/ABCC2 internalization is determined by Ezrin Thr567 phosphorylation in human obstructive cholestasis.
26209696 2015 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26149384 2015 Ezrin Binds to DEAD-Box RNA Helicase DDX3 and Regulates Its Function and Protein Level.
26135398 2015 Co-Expression of Ezrin-CLIC5-Podocalyxin Is Associated with Migration and Invasiveness in Hepatocellular Carcinoma.
26115722 2015 Eight proteins play critical roles in RCC with bone metastasis via mitochondrial dysfunction.
More...