Property Summary

NCBI Gene PubMed Count 386
PubMed Score 942.22
PubTator Score 511.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 8.80041798045858E-15
acute quadriplegic myopathy 1157 7.14538637510726E-12
juvenile dermatomyositis 1189 5.44654976022335E-9
Amyotrophic Lateral Sclerosis 432 4.44534316200655E-8
posterior fossa group B ependymoma 1530 1.16399524472181E-7
Duchenne muscular dystrophy 602 4.19628329289945E-7
lung cancer 4473 8.26507943326073E-7
pancreatic cancer 2300 2.96427149362793E-6
pituitary cancer 1972 4.76808752088938E-6
osteosarcoma 7933 1.62853002761918E-5
interstitial cystitis 2299 2.62253299192846E-5
atypical teratoid / rhabdoid tumor 4369 3.20383922697076E-5
Becker muscular dystrophy 187 7.09072973248202E-5
gastric cancer 436 7.35058383990304E-5
pancreatic carcinoma 567 1.02982058780772E-4
breast carcinoma 1614 1.7095108464356E-4
invasive ductal carcinoma 2950 6.15116636263009E-4
psoriasis 6685 8.79256758460847E-4
Down syndrome 548 0.00152749613394981
ductal carcinoma in situ 1745 0.00194609420800521
group 3 medulloblastoma 2254 0.00213649762826431
tuberculosis 1563 0.0027360328609383
urothelial carcinoma 318 0.00511713877676109
glioblastoma 5572 0.010453905976125
pancreatic ductal adenocarcinoma liver metastasis 1795 0.013542554057738
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0141801069779453
diabetes mellitus 1663 0.0159073895412602
oligodendroglioma 2849 0.0174205236520474
Rheumatoid Arthritis 1171 0.0230499945978312
Breast cancer 3099 0.0260219833290876
Polycystic Ovary Syndrome 335 0.0263604920652459
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0283974065425728
aldosterone-producing adenoma 664 0.0357981706220756
sarcoidosis 368 0.0431651110089249
Common variable immunodeficiency 98 0.0478930605611336
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0483038566235785

Expression

Synonym

Accession P15311 E1P5A8 P23714 Q4VX75 Q96CU8 Q9NSJ4
Symbols CVL
CVIL
VIL2
HEL-S-105

Gene

EZR

PDB

1NI2   4RM8   4RM9   4RMA  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (306)

PMID Text
26927385 Data show that both Ezrin and SIX1 proteins are highly expressed in alpha fetoprotein-negative hepatocellular carcinoma (HCC) and significantly related with the TNM stage.
26555866 Phospho-Ezrin/Radixin/Moesin (ERM) inhibit cell adhesion, and therefore, dephosphorylation of ERM proteins is essential for cell adhesion.Phospho-ERM induce formation and/or maintenance of spherical cell shape.
26419932 it was found that expression of miR-96 was negatively correlated with the metastatic ability of renal cell carcinoma, and that downregulation of miR-96 could suppress the invasion of renal cancer cell via downregulation of Ezrin expression.
26360636 HIV-1 MA interacts with EZR
26360636 siRNA knockdown of EZR enhances HIV-1 replication; HIV-1 replication is restricted by EZR
26358752 Data indicate that a quinoline-based small molecule, NSC305787, directly binds to ezrin and inhibits its functions.
26330014 We identified and confirmed that Fra-1 affected the expression level of CTTN and EZR in vitro through LC-MS/MS analyses and western blot technology.
26212029 Activation of liver PKCs during cholestasis leads to Ezrin Thr567 phosphorylation resulting in MRP2 internalization and degradation where ubiquitin ligase E3 GP78 is involved.
26209696 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26149384 ezrin controls the translation of mRNAs preferentially with a structured 5' untranslated region, at least in part, by sustaining the protein level of DDX3 and/or regulating its function.
More...

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV      1 - 70
RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE     71 - 140
VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN    141 - 210
KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI    211 - 280
LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR    281 - 350
LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE    351 - 420
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ    421 - 490
DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ    491 - 560
GRDKYKTLRQIRQGNTKQRIDEFEAL                                                561 - 586
//

Text Mined References (393)

PMID Year Title
26927385 2016 [Clinicopathological significance of ezrin and SIX1 protein expression in alpha fetoprotein-negative hepatocellular carcinoma].
26555866 2015 Inhibition of cell adhesion by phosphorylated Ezrin/Radixin/Moesin.
26419932 2015 miR-96 suppresses renal cell carcinoma invasion via downregulation of Ezrin expression.
26358752 2015 Identification of Novel Ezrin Inhibitors Targeting Metastatic Osteosarcoma by Screening Open Access Malaria Box.
26330014 2015 Fra-1 is upregulated in gastric cancer tissues and affects the PI3K/Akt and p53 signaling pathway in gastric cancer.
26212029 2015 Canalicular membrane MRP2/ABCC2 internalization is determined by Ezrin Thr567 phosphorylation in human obstructive cholestasis.
26209696 2015 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26149384 2015 Ezrin Binds to DEAD-Box RNA Helicase DDX3 and Regulates Its Function and Protein Level.
26135398 2015 Co-Expression of Ezrin-CLIC5-Podocalyxin Is Associated with Migration and Invasiveness in Hepatocellular Carcinoma.
26115722 2015 Eight proteins play critical roles in RCC with bone metastasis via mitochondrial dysfunction.
More...