Property Summary

NCBI Gene PubMed Count 423
PubMed Score 981.26
PubTator Score 511.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (36)

Disease log2 FC p
acute quadriplegic myopathy 1.563 2.5e-08
aldosterone-producing adenoma -2.005 3.6e-02
Amyotrophic lateral sclerosis 1.159 6.6e-07
atypical teratoid / rhabdoid tumor 1.900 1.7e-04
Becker muscular dystrophy 1.200 7.1e-05
Breast cancer 2.400 2.6e-02
breast carcinoma 1.200 1.7e-04
Common variable immunodeficiency 1.199 4.8e-02
diabetes mellitus -1.700 1.6e-02
Down syndrome 1.100 1.5e-03
Duchenne muscular dystrophy 1.091 4.2e-07
ductal carcinoma in situ 1.900 1.9e-03
ependymoma 1.600 4.0e-02
gastric cancer -1.400 7.4e-05
glioblastoma 1.300 2.6e-02
group 3 medulloblastoma 1.800 1.1e-02
interstitial cystitis -1.200 4.2e-02
intraductal papillary-mucinous adenoma (... 1.300 3.4e-03
intraductal papillary-mucinous carcinoma... 1.200 1.9e-02
intraductal papillary-mucinous neoplasm ... 1.300 4.8e-02
invasive ductal carcinoma 1.700 6.6e-04
juvenile dermatomyositis 1.328 5.4e-09
lung cancer -2.200 6.8e-03
oligodendroglioma 1.600 8.7e-03
osteosarcoma 1.309 3.6e-04
ovarian cancer -2.400 2.4e-10
pancreatic cancer -1.300 1.0e-04
pancreatic carcinoma -1.300 1.0e-04
pancreatic ductal adenocarcinoma liver m... 2.116 1.4e-02
pituitary cancer -1.700 2.3e-04
Polycystic ovary syndrome -1.169 2.6e-02
psoriasis 1.800 8.8e-04
Rheumatoid arthritis 1.600 2.3e-02
sarcoidosis -1.100 4.3e-02
tuberculosis -1.100 2.7e-03
urothelial carcinoma -1.100 5.1e-03

Protein-protein Interaction (4)

Gene RIF (338)

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV      1 - 70
RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE     71 - 140
VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN    141 - 210
KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI    211 - 280
LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR    281 - 350
LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE    351 - 420
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ    421 - 490
DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ    491 - 560
GRDKYKTLRQIRQGNTKQRIDEFEAL                                                561 - 586
//

Text Mined References (430)

PMID Year Title