Property Summary

NCBI Gene PubMed Count 83
Grant Count 116
R01 Count 79
Funding $10,835,039.45
PubMed Score 246.69
PubTator Score 893.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 3.100 0.000
osteosarcoma -2.267 0.000
tuberculosis 2.100 0.000
lung cancer -1.200 0.001
active Crohn's disease 1.811 0.002
active ulcerative colitis 1.648 0.007
spina bifida -1.145 0.027
ovarian cancer -2.400 0.000

Synonym

Accession P15309 D3DNC6 Q5FBY0 Q96KY0 Q96QK9 Q96QM0 PAP
Symbols ACP3
5'-NT
ACP-3

Gene

PANTHER Protein Class (2)

PDB

1CVI   1ND5   1ND6   2HPA   2L3H   2L77   2L79   2MG0   3PPD  

Gene RIF (39)

PMID Text
26419820 Prostatic acid phosphatase delays prostate cancer cell growth in G1 phase of the cell cycle.
25740984 Certain factors identified within semen, termed semen-derived enhancers of virus infection (SEVI), fragments of prostatic acid phosphatase, have been shown to significantly enhance HIV-1 infectivity.
24854630 GCNT1 is over-expressed in prostate cancer and is associated with higher levels of core 2 O-sLe(x) in PSA, PAP and MUC1 proteins.
24829029 ACPP increases significantly in epithelial cells of ovarian carcinoma, which indicates that it may be a candidate biomarker for diagnosis of epithelia-derived ovarian cancer in women.
24434023 Data indicate that hypoxia regulates prostatic acid phosphatase (PAP) through hypoxia-inducible factor 2 alpha (HIF2alpha) and from stimulated A2B adenosine receptors.
24338683 Data indicate that prostate acid phosphatase-based peptide vaccine PAP-114-128 peptide appears to be a relevant for the treatment of prostate cancer.
23897810 Soluble ecto-5'-nucleotidase (5'-NT), alkaline phosphatase, and adenosine deaminase (ADA1) activities in neonatal blood favor elevated extracellular adenosine.
23698773 Studies suggest that understanding of prostatic acid phosphatase function and regulation of expression will have a significant impact on understanding prostate cancer (PCa) progression and therapy.
23314347 PAPf39 is a 39 residue peptide fragment from human prostatic acidic phosphatase. Recombinant PAPf39 showed amyloid fibril formation.
22354963 in the in vivo environment, PAP(248-286) is likely to form fibrils efficiently, thus providing an explanation for the presence of semen-derived enhancer of viral infection in human semen.
More...

AA Sequence

MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQL      1 - 70
TQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQP     71 - 140
IPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVY    141 - 210
DPLYCESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSY    211 - 280
KKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPS    281 - 350
CPLERFAELVGPVIPQDWSTECMTTNSHQGTEDSTD                                      351 - 386
//

Publication (91)

PMID Year Title
26419820 2016 Transmembrane prostatic acid phosphatase (TMPAP) delays cells in G1 phase of the cell cycle.
25740984 2015 Characterization of the Influence of Semen-Derived Enhancer of Virus Infection on the Interaction of HIV-1 with Female Reproductive Tract Tissues.
24854630 2014 Increased expression of GCNT1 is associated with altered O-glycosylation of PSA, PAP, and MUC1 in human prostate cancers.
24829029 2014 Avian prostatic acid phosphatase: estrogen regulation in the oviduct and epithelial cell-derived ovarian carcinomas.
24657436 2014 Peptides derived from HIV-1 gp120 co-receptor binding domain form amyloid fibrils and enhance HIV-1 infection.
24434023 2014 The HIF-2alpha dependent induction of PAP and adenosine synthesis regulates glioblastoma stem cell function through the A2B adenosine receptor.
24338683 2014 Novel prostate acid phosphatase-based peptide vaccination strategy induces antigen-specific T-cell responses and limits tumour growth in mice.
23897810 2013 Soluble ecto-5'-nucleotidase (5'-NT), alkaline phosphatase, and adenosine deaminase (ADA1) activities in neonatal blood favor elevated extracellular adenosine.
23698773 2013 Human prostatic acid phosphatase: structure, function and regulation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...