Property Summary

NCBI Gene PubMed Count 65
Grant Count 27
R01 Count 10
Funding $1,866,740.76
PubMed Score 197.54
PubTator Score 182.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis -4.100 0.000
osteosarcoma -2.234 0.000
cystic fibrosis 1.059 0.005
astrocytoma 1.700 0.015
glioblastoma 1.800 0.005
medulloblastoma, large-cell 1.100 0.000
lung cancer -2.300 0.001
adult high grade glioma -1.100 0.005
lung carcinoma -1.400 0.000
ovarian cancer 1.300 0.000

 GWAS Trait (1)

Gene RIF (38)

PMID Text
26315939 We suggest that the unique expression patterns for the B4GALT1 in normal and malignant tissues are controlled by a differential usage of 5'-B4GALT1 regulatory units along with a post-transcriptional regulation by the antisense RNA
26191157 Human chorionic gonadotropin provides a mechanism to bridge embryo to endometrium through beta1,4-GalT.
25936519 HS5 cells had significantly enhanced levels of bisecting N-glycans (catalyzed by MGAT3 whereas HS27a cells had enhanced levels of Galbeta1,4GlcNAc.
25223470 plays a role in activation of T-lymphocytes and participates in intercellular contact formation
23744354 B4GALT1 and B4GALT5, two members of B4GALT gene family, are involved in the development of multidrug resistance of human leukemia cells.
23583406 RNAi-mediated knockdown of beta1,4GT1 increased the levels of EGFR dimerization and phosphorylation. These data suggest that cell surface beta1,4GT1 interacts with EGFR and inhibits EGFR activatio
22982306 estrogen regulates the expression of B4GALT1 through the direct binding of ER-alpha to ERE; the expressed B4GALT1 plays a crucial role in the proliferation of MCF-7 cells through its activity as a membrane receptor.
22927297 the glycogene B4GALT1 represent a valuable candidate biomarker of invasive phenotype of colorectal cancer.
22847114 Osteopontin increases the expression of beta1, 4-Galactosyltransferase-I and promotes adhesion in human RL95-2 cells, the activity critical for embryo implantation.
22740701 beta4Gal-T1 molecule has two different oligosaccharide binding regions for the binding of the extended oligosaccharide moiety of the acceptor substrate.
More...

AA Sequence

MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAI      1 - 70
GQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGP     71 - 140
MLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYG    141 - 210
IYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSL    211 - 280
PYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNE    281 - 350
PNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS                          351 - 398
//

Text Mined References (68)

PMID Year Title
26315939 2015 Multifaceted roles of 5'-regulatory region of the cancer associated gene B4GALT1 and its comparison with the gene family.
26191157 2015 HCG induces ?1,4-GalT I expression and promotes embryo implantation.
25936519 2015 Quantitative analysis of glycans, related genes, and proteins in two human bone marrow stromal cell lines using an integrated strategy.
25223470 2014 ?-1,4-galactosyltransferase-I activates proliferation and participates in intercellular contacts of lymphocytes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23744354 2013 B4GALT family mediates the multidrug resistance of human leukemia cells by regulating the hedgehog pathway and the expression of p-glycoprotein and multidrug resistance-associated protein 1.
23583406 2013 Direct interaction between surface ?1,4-galactosyltransferase 1 and epidermal growth factor receptor (EGFR) inhibits EGFR activation in hepatocellular carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...