Property Summary

NCBI Gene PubMed Count 68
PubMed Score 211.11
PubTator Score 182.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 4.5e-03
astrocytoma 1.700 1.5e-02
cystic fibrosis 1.059 5.5e-03
glioblastoma 1.800 5.1e-03
lung cancer -2.300 1.0e-03
lung carcinoma -1.400 3.9e-25
malignant mesothelioma -1.300 3.6e-05
medulloblastoma, large-cell 1.100 1.2e-04
osteosarcoma -1.384 9.8e-06
ovarian cancer 1.300 1.3e-04
psoriasis -4.100 2.8e-06

Gene RIF (41)

AA Sequence

MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAI      1 - 70
GQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGP     71 - 140
MLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYG    141 - 210
IYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSL    211 - 280
PYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNE    281 - 350
PNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS                          351 - 398
//

Text Mined References (71)

PMID Year Title