Property Summary

NCBI Gene PubMed Count 157
Grant Count 61
R01 Count 36
Funding $4,279,276.23
PubMed Score 160.86
PubTator Score 171.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Endometriosis -1.127 0.008
Multiple myeloma 1.354 0.039
esophageal adenocarcinoma 1.200 0.022
osteosarcoma 1.992 0.000
chronic lymphosyte leukemia -1.300 0.000
astrocytoma 1.100 0.040
glioblastoma 2.100 0.000
hereditary spastic paraplegia -1.109 0.002
juvenile dermatomyositis 1.062 0.000
acute quadriplegic myopathy 1.248 0.000
pancreatic ductal adenocarcinoma liver m... -1.521 0.021
lung cancer -2.200 0.000
primary Sjogren syndrome 1.500 0.003
lung adenocarcinoma -1.500 0.000
lung carcinoma -1.500 0.000
ovarian cancer -2.000 0.000
Down syndrome 1.300 0.000

Synonym

Accession P15260 B4DFT7 E1P587 Q53Y96 IFN-gamma receptor 1
Symbols CD119
IFNGR
IMD27A
IMD27B

Gene

PDB

1FG9   1FYH   1JRH  

Gene RIF (147)

PMID Text
27020872 A significant association of IFN-gammaR1 and P2X7 genes polymorphisms with risk of developing TB in Iranian population.
26343451 Targeted deep sequencing identifies rare loss-of-function variants in IFNGR1 for risk of atopic dermatitis complicated by eczema herpeticum
26251056 Mendelian susceptibility to mycobacteria due to a partial dominant mutation of the interferon gamma receptor 1 gene.
26172439 Vpu-mediated modulation of IFNA (IFN-1) production by plasmacytoid dendritric cells requires the presence of BST2 on infected donor cells
25815589 Statistical analyses revealed that four genetic variants in IFNGR1 were marginally associated with the risk of Tuberculosis (P = 0.02-0.04), while other single nucleotide polymorphisms in IFNGR1 and IFNGR2 did not exhibit any associations
25708927 In an African-American population, a significant difference in IFNGR1 expression between patients with RA and controls. However, IFNGR1 expression levels were not statistically significantly associated with erosion status or other radiographic outcomes.
25466928 Uniformly low expression of IFN and IFNGR1 in post Kala-azar dermal leishmaniasis skin biopsies could explain parasite persistence and is consistent with prior demonstration of genetic association with IFNGR1 polymorphisms.
25275127 Vpu-mediated modulation of IFNA (IFN-1) production by plasmacytoid dendritric cells requires the presence of BST2 on infected donor cells
25275127 Vpu-mediated modulation of IFNA (IFN-1) production by plasmacytoid dendritric cells requires the presence of BST2 on infected donor cells
25242146 The study identifies a mechanism of cellular signaling regulated by extracellular vesicles -associated IFN-gamma/Ifngr1 complexes, which grafted stem cells may use to communicate with the host immune system.
More...

AA Sequence

MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKN      1 - 70
SEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQ     71 - 140
IMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLN    141 - 210
SQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKS    211 - 280
IILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELS    281 - 350
SITEVVTTEENIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE    351 - 420
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTEDSKEFS     421 - 489
//

Text Mined References (160)

PMID Year Title
27020872 2016 Association of IFN-? and P2X7 Receptor Gene Polymorphisms in Susceptibility to Tuberculosis Among Iranian Patients.
26343451 2015 Targeted deep sequencing identifies rare loss-of-function variants in IFNGR1 for risk of atopic dermatitis complicated by eczema herpeticum.
26251056 2015 [Disseminated BCG disease revealing a partial deficiency in receptor 1 interferon gamma].
25815589 2015 Association study of polymorphisms in interferon-? receptor genes with the risk of pulmonary tuberculosis.
25708927 2015 Expression of Interferon-? Receptor Genes in Peripheral Blood Mononuclear Cells Is Associated With Rheumatoid Arthritis and Its Radiographic Severity in African Americans.
25466928 2014 Insights into the possible role of IFNG and IFNGR1 in Kala-azar and Post Kala-azar Dermal Leishmaniasis in Sudanese patients.
25242146 2014 Extracellular vesicles from neural stem cells transfer IFN-? via Ifngr1 to activate Stat1 signaling in target cells.
25108563 2015 Fc?RIIa cross-talk with TLRs, IL-1R, and IFN?R selectively modulates cytokine production in human myeloid cells.
24680779 2014 Genetic polymorphisms of IFNG and IFNGR1 in association with the risk of pulmonary tuberculosis.
24453034 2014 Association study of SNPs of genes IFNGR1 (rs137854905), GSTT1 (rs71748309), and GSTP1 (rs1695) in gastric cancer development in samples of patient in the northern and northeastern Brazil.
More...