Property Summary

NCBI Gene PubMed Count 157
PubMed Score 160.86
PubTator Score 171.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (17)

Disease log2 FC p
Endometriosis -1.127 8.1e-03
Multiple myeloma 1.354 3.9e-02
esophageal adenocarcinoma 1.200 2.2e-02
osteosarcoma 1.992 3.5e-04
chronic lymphosyte leukemia -1.300 6.0e-11
astrocytoma 1.100 4.0e-02
glioblastoma 2.100 2.5e-04
hereditary spastic paraplegia -1.109 1.5e-03
juvenile dermatomyositis 1.062 6.8e-12
acute quadriplegic myopathy 1.248 2.5e-06
pancreatic ductal adenocarcinoma liver m... -1.521 2.1e-02
lung cancer -2.200 4.5e-05
primary Sjogren syndrome 1.500 2.7e-03
lung adenocarcinoma -1.500 6.3e-17
lung carcinoma -1.500 8.9e-20
ovarian cancer -2.000 6.0e-08
Down syndrome 1.300 1.9e-04

Gene RIF (146)

PMID Text
27020872 A significant association of IFN-gammaR1 and P2X7 genes polymorphisms with risk of developing TB in Iranian population.
26343451 Targeted deep sequencing identifies rare loss-of-function variants in IFNGR1 for risk of atopic dermatitis complicated by eczema herpeticum
26251056 Mendelian susceptibility to mycobacteria due to a partial dominant mutation of the interferon gamma receptor 1 gene.
26172439 Vpu-mediated modulation of IFNA (IFN-1) production by plasmacytoid dendritric cells requires the presence of BST2 on infected donor cells
25815589 Statistical analyses revealed that four genetic variants in IFNGR1 were marginally associated with the risk of Tuberculosis (P = 0.02-0.04), while other single nucleotide polymorphisms in IFNGR1 and IFNGR2 did not exhibit any associations
25708927 In an African-American population, a significant difference in IFNGR1 expression between patients with RA and controls. However, IFNGR1 expression levels were not statistically significantly associated with erosion status or other radiographic outcomes.
25466928 Uniformly low expression of IFN and IFNGR1 in post Kala-azar dermal leishmaniasis skin biopsies could explain parasite persistence and is consistent with prior demonstration of genetic association with IFNGR1 polymorphisms.
25275127 Vpu-mediated modulation of IFNA (IFN-1) production by plasmacytoid dendritric cells requires the presence of BST2 on infected donor cells
25242146 The study identifies a mechanism of cellular signaling regulated by extracellular vesicles -associated IFN-gamma/Ifngr1 complexes, which grafted stem cells may use to communicate with the host immune system.
25108563 FcgammaRIIa cross-talk with TLRs, IL-1R, and IFNgammaR selectively modulates cytokine production in human myeloid cells.
24680779 Genetic polymorphisms in IFNGR1 gene are involved in the risk of tuberculosis in the Chinese population.
24453034 work aimed to evaluate single nucleotide polymorphisms (SNPs) of IFNGR1, GSTT1, and GSTP1 genes samples in gastric cancer
24254535 Intact IFN-gammaR1 expression and function distinguishes Langerhans cell histiocytosis from mendelian susceptibility to mycobacterial disease.
24220318 A novel heterozygous frameshift mutation (805delT) encoding the IFN-gamma receptor 1 (IFNGR1) was identified, presenting in a case of Mycobacterium intracellulare infection.
24199198 Increasing affinity of interferon-gamma receptor 1 to interferon-gamma by computer-aided design.
23935197 These data suggest that type I IFN stimulation induces a rapid recruitment of a repressive Egr3/Nab1 complex that silences transcription from the ifngr1 promoter.
23040881 An association study of functional polymorphic genes .... IFNGR-1, ...... with disease progression, aspartate aminotransferase, alanine aminotransferase, and viral load in chronic hepatitis B and C.
22711893 Absence of early innate IFN-gamma production in transgenic mice with combined defects in both IL-12 and type I IFN receptor negates the impact of programmed death ligand-1 blockade.
22644879 Interaction of IFNgammaR1 with TRAF6 regulates NF-kappaB activation and IFNlambdaR1 stability.
22595141 A novel endocytosis motif shares characteristics of tyrosine-based and dileucine-based internalization sequences and is highly conserved in IFN-gamma receptors across species.
22564607 Monocyte-derived CD40 expression is regulated by interferon-gamma/interferon-gamma receptor-1 pathway when acting as a bridge during their interaction with T cells and allogeneic endothelial cells.
21859832 Single nucleotide polymorphism in IFNGR1 gene is associated with rectal cancer.
21731057 IFNGR1 is a modifier gene of cystic fibrosis disease.
21722521 CD74 gene over-expression in TEC can increase IFN-gammaR mRNA expression
21460021 The autosomal recessive disorder, because of a single mutation in interferon-gamma receptor-1(IFNGR1) at position -56, was found to be associated with susceptibility to leprosy in children of the same family.
21221749 The Japanese patients with a genetic mutation in the IFN-gamma-R1 gene were more susceptible to developing recurrent disseminated mycobacterial infections.
21190998 IL-29 up-regulated, whereas IFNalpha down-regulated, the surface expression of the IFNgamma receptor 1 chain on macrophages, thereby resulting in differential responsiveness of TLR-challenged macrophages to IFNgamma.
20980339 Observational study of gene-disease association. (HuGE Navigator)
20959405 Observational study of gene-disease association. (HuGE Navigator)
20799037 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20500698 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20412699 results do not show an implication of IFNGR1gene polymorphisms in the susceptibility to and clinical expression of giant cell arteritis
20412699 Observational study of gene-disease association. (HuGE Navigator)
20399512 Clinical trial of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20196868 Observational study of gene-disease association. (HuGE Navigator)
20070287 study showed a positive association between -56C/C genotype of IFNGR1 (OR = 1.7; 95% CI = 1.1-2.7) and pre-eclampsia.
20070287 Observational study of gene-disease association. (HuGE Navigator)
20055726 Observational study of gene-disease association. (HuGE Navigator)
20015550 Functional analysis of naturally occurring amino acid substitutions in human IFN-gammaR1.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19739012 The urinary soluble IFN-gamma receptor levels did not correlate with the clinical severity of vesicoureteral reflux
19734231 A putative SOCS-1 binding site, tyrosine 441 on IFN-gamma receptor subunit 1, contributes to the regulation of interferon-gamma signaling through recruitment of SOCS-1 in wild-type but not mutant cells.
19723394 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19712753 A case-control association analysis failed to detect significant association between the IFNGR1 polymorphisms and cerebral malaria in the Thai population
19692168 Observational study of gene-disease association. (HuGE Navigator)
19681704 The interleukin-12/interferon-gamma axis appears to be critical for control of coccidioidomycosis and mycobacteriosis in interferon-gamma receptor 1 deficiency with a IFNGR1 mutation
19625176 Observational study of gene-disease association. (HuGE Navigator)
19575238 Strong association with this gene and pulmonary tuberculosis susceptibility in African Americans.
19488747 Results show that that a functional -56C/T SNP in IFNGR1 promoter is associated with the clinical outcome of HBV infection in this Chinese population.
19488747 Observational study of gene-disease association. (HuGE Navigator)
19279332 Tat impaired the IFNgamma-receptor signaling pathway at the level of STAT1 activation, possibly via Tat-dependent induction of SOCS-2 activity.
19269302 Results show a significant down regulation in expression of the alpha-chain of the IFN-gamma receptor on surfaces of alveolar macrophages acquired from smokers when compared with non-smokers.
19247692 Observational study of gene-disease association. (HuGE Navigator)
19172849 the transcriptional of IFNgRb/IFNgRa in the heart bioptates appeared to be an early and sensitive marker of inflammatory status of patients with myocarditis
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
18953482 Observational study of gene-disease association. (HuGE Navigator)
18931463 Finds lack of association between functional polymorphisms in intron 1 of IFN-gamma gene at position +874 and silicosis and pulmonary tuberculosis in Chinese iron miners
18809513 The urine evaluation of the balance between IFN-gammaR1 and IL4R receptors might be informative for the immune states of HUS patients.
18702743 allele (CA)(25)of the interferon gamma receptor 1 gene appeared to be susceptible to TB, while the allele (CA)(26) was protective towards TB
18676680 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18620489 with progression of HIV-1 infection, interferon-gamma production declines whereas expression of interferon-gamma receptors (R1 and R2) increases
18593809 results indicate that the IFNGR1 -56C/T polymorphism is a relevant host susceptibility factor for Gastric Carcinoma development.
18593809 Observational study of gene-disease association. (HuGE Navigator)
18555234 Regulation of the IFN-gamma R and its signaling response in human endometrial stromal cells during decidualization.
18548239 The polymorphisms in the IFNG and IFNGR1 genes were studied with the aim of clarifying the relationships among these polymorphisms, penicillin allergy and anti-penicillin antibodies.
18548239 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18414508 Frequent mutations in microsatellite-instable (MSI-H) tumours and cell lines of a conserved A14 repeat within the 3'-untranslated region of the interferon-gamma receptor 1 gene (IFNGR1).
18287876 Observational study of gene-disease association. (HuGE Navigator)
17986123 Observational study of gene-disease association. (HuGE Navigator)
17986123 The IFN-gamma receptor 1 gene polymorphism does not appear to be responsible for host susceptibility to pulmonary tuberculosis in the Korean population.
17697357 expressed IFNgamma and IFNgamma-Ralpha together with the nuclear localization of IFNgamma-Rbeta, could be a tumoral cell response
17618444 Observational study of gene-disease association. (HuGE Navigator)
17618444 IFNGR polymorphisms (Val14Met and Gln64Arg) are protective in systemic lupus erythematosus in Chinese patients
17572155 Observational study of genotype prevalence. (HuGE Navigator)
17546485 Variation in transcriptional activity of genes encoding INF-gamma receptor subunits may affect function of microvasculature and thereby participate in the pathology of cardiac syndrome X
17513528 A deletion in this receptor produces a truncated form of IFNgammaR1, which has a dominant-negative effect on IFNgamma signal transduction through altered receptor stability.
17477815 Observational study of gene-disease association. (HuGE Navigator)
17431682 Observational study of gene-disease association. (HuGE Navigator)
17431682 analyzed candidate genes related to TNFalpha regulation and found that interleukin (IL)-10, interferon-gamma receptor 1 (IFNGR1), and TNFalpha receptor 1 (TNFR1) genes were linked and associated to both tuberculosis and TNFalpha
17392024 Observational study of gene-disease association. (HuGE Navigator)
17348823 Observational study of gene-disease association. (HuGE Navigator)
17339358 expression downregulated by Mycobacterium tuberculosis in human cells as immune evasion mechanism.
17251453 Observational study of gene-disease association. (HuGE Navigator)
17251453 The -56T allele in the IFNGR1 promoter results in higher IFNGR1 transcriptional activity and represents a genetic risk factor for atopic cataracts.
17166914 The K3 and K5 proteins of Kaposi's sarcoma-associated herpesvirus (KSHV) both specifically target IFN-gammaR1 and induce its ubiquitination, endocytosis, and degradation.
17152005 Observational study of gene-disease association. (HuGE Navigator)
17136124 Observational study of gene-disease association. (HuGE Navigator)
17136124 The results suggest a complex pattern of haplotypic variation at the IFNGR1 promoter locus associated with post-kala-azar dermal leishmanaisis susceptibility.
17030574 Infection of HEK 293 cells with C. psittaci increased IFN-gammaR expression only in cells expressing either TLR2 or TLR4 and the adaptor protein MD-2.
17023216 Observational study of gene-disease association. (HuGE Navigator)
16944293 Observational study of gene-disease association. (HuGE Navigator)
16944293 no statistically significant association with susceptibility to persistent HBV infection was observed with the IFN-gamma, IFNGR-1 and 2, and IRF-1 gene polymorphisms under the codominant, dominant, and recessive models
16867043 Observational study of gene-disease association. (HuGE Navigator)
16785527 Interferon (IFN)-gamma and its receptor subunit IFNGR1 bind to the IFN-gamma-activated sequence (GAS) response element in the promoter region of IFN-gamma-activated genes. This binding results in enhanced activation of IFN-gamma-induced genes.
16690980 Observational study of gene-disease association. (HuGE Navigator)
16690980 Novel tuberculosis association was found with the 56CC genotype of the IFNGR1 promotor.
16563189 Observational study of gene-disease association. (HuGE Navigator)
16563189 IFNGR1 does not contribute to susceptibility to rheumatoid arthritis in Caucasians, although a single nucleotide polymorphisms exist in this disease.
16491350 Observational study of gene-disease association. (HuGE Navigator)
16476014 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16233916 Observational study of gene-disease association. (HuGE Navigator)
16233916 The relationship between polymorphisms at IFNGR1 and susceptibility to pulmonary tuberculosis is reported in Iranian patients.
16115485 Observational study of gene-disease association. (HuGE Navigator)
16115485 IFNG T874A, IFNGR1 C-56T and IFNGR2 A839G genotypes were not associated with the incidence of angiographic and clinical restenosis (P>0.23).
15952126 The IFN-GammaR2 Arg64/Arg64 genotype does not determine susceptibility to SLE in Chinese people, and the combination of IFN-Gamma R2 Arg64/Arg64 genotype and IFN-Gamma R1 Val14/Val14 genotype does not, either.
15952126 Observational study of gene-disease association. (HuGE Navigator)
15756299 disease susceptibility in Schistosoma mansoni infection to hepatic fibrosis is linked to a SNP in the interferon gamma receptor locus (P=0.000001).
15527154 Observational study of gene-disease association. (HuGE Navigator)
15207788 Observational study of gene-disease association. (HuGE Navigator)
15182327 Observational study of gene-disease association. (HuGE Navigator)
15047947 Observational study of gene-disease association. (HuGE Navigator)
15004750 Observational study of gene-disease association. (HuGE Navigator)
14763782 Observational study of gene-disease association. (HuGE Navigator)
14734726 IFN-gamma receptor deficiency alters the epitope hierarchy of the pool of lymphocytic choriomeningitis virus-specific memory CD8 T cells without significantly affecting the immunodominance of the primary CD8 T cell response in an acute infection.
12851715 Observational study of gene-disease association. (HuGE Navigator)
12851715 In this study, although IFN-gamma production in the allergic patients with L467P was equivalent to that in the non-allergic subjects, their serum IgE levels were high and they had allergic diseases
12753505 Observational study of gene-disease association. (HuGE Navigator)
12753505 Unidentified allelic variations in the IFNGR1 gene might elevate or decrease the risk in the Croatian population, as a part of the multigenic predisposition to tuberculosis.
12743658 Observational study of gene-disease association. (HuGE Navigator)
12743658 Mutations have no association with the susceptibility to lepromatous leprosy in the Korean population.
12543882 MHC Class II proteins, interferon-alpha, interferon-gamma receptor and the capacity to present antigen may be crucial in HIV-associated nephropathy pathogenesis.
12516030 Genome analysis identified polymorphism in the human interferon gamma receptor affecting Helicobacter pylori infection.
12454749 suppressed by 2- to 3-fold in B-cell chronic lymphocytic leukemia cells, which is expected to increase CLL cell survival
12438563 FRET was used to demonstrate that the IFNGR chains were preassembled on the cell membrane.
12244188 Partial deficiency of IFN-gamma receptor 1 results in abrogation of IFN-gamma-induced killing of Salmonella typhimurium and Toxoplasma gondii due to IFN-gamma unresponsiveness of patients' cells of the monocyte/macrophage lineage.
12165521 Lipid microdomains are required sites for the selective endocytosis and nuclear translocation of IFN-gamma receptor-1.
12034035 This study identified a further role of IFN-gamma on IL-4 responses, including reduced IL-4R surface expression by human monocytes.
12027427 Mutations in interferon-gamma receptor 1.
12023780 Observational study of gene-disease association. (HuGE Navigator)
12023780 IFNGR1 gene promoter polymorphisms may be assocaited with susceptibility to cerebral malaria
12020266 Observational study of gene-disease association. (HuGE Navigator)
11865431 partial IFNGR1 mutations in Japanese patients with BCG osteomyelitis
11857344 IL-12R beta 1- and IFN-gamma R1 signals co-ordinately regulate IFN-gamma production, but only IL-12 negatively controls IL-4 production. IL-12 and IFN-gamma signals are each sufficient for IFN-gamma production but both are needed for optimal production.
11240951 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKN      1 - 70
SEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQ     71 - 140
IMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLN    141 - 210
SQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKS    211 - 280
IILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELS    281 - 350
SITEVVTTEENIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE    351 - 420
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTEDSKEFS     421 - 489
//

Text Mined References (160)

PMID Year Title
27020872 2016 Association of IFN-? and P2X7 Receptor Gene Polymorphisms in Susceptibility to Tuberculosis Among Iranian Patients.
26343451 2015 Targeted deep sequencing identifies rare loss-of-function variants in IFNGR1 for risk of atopic dermatitis complicated by eczema herpeticum.
26251056 2015 [Disseminated BCG disease revealing a partial deficiency in receptor 1 interferon gamma].
25815589 2015 Association study of polymorphisms in interferon-? receptor genes with the risk of pulmonary tuberculosis.
25708927 2015 Expression of Interferon-? Receptor Genes in Peripheral Blood Mononuclear Cells Is Associated With Rheumatoid Arthritis and Its Radiographic Severity in African Americans.
25466928 2014 Insights into the possible role of IFNG and IFNGR1 in Kala-azar and Post Kala-azar Dermal Leishmaniasis in Sudanese patients.
25242146 2014 Extracellular vesicles from neural stem cells transfer IFN-? via Ifngr1 to activate Stat1 signaling in target cells.
25108563 2015 Fc?RIIa cross-talk with TLRs, IL-1R, and IFN?R selectively modulates cytokine production in human myeloid cells.
24680779 2014 Genetic polymorphisms of IFNG and IFNGR1 in association with the risk of pulmonary tuberculosis.
24453034 2014 Association study of SNPs of genes IFNGR1 (rs137854905), GSTT1 (rs71748309), and GSTP1 (rs1695) in gastric cancer development in samples of patient in the northern and northeastern Brazil.
24254535 2014 Intact IFN-?R1 expression and function distinguishes Langerhans cell histiocytosis from mendelian susceptibility to mycobacterial disease.
24220318 2014 A novel mutation in IFN-? receptor 1 presenting as multisystem Mycobacterium intracellulare infection.
24199198 2013 Increasing affinity of interferon-? receptor 1 to interferon-? by computer-aided design.
23935197 2013 Type I IFNs downregulate myeloid cell IFN-? receptor by inducing recruitment of an early growth response 3/NGFI-A binding protein 1 complex that silences ifngr1 transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23040881 2013 An association study of functional polymorphic genes IRF-1, IFNGR-1, and IFN-? with disease progression, aspartate aminotransferase, alanine aminotransferase, and viral load in chronic hepatitis B and C.
22711893 2012 Innate IFN-? is essential for programmed death ligand-1-mediated T cell stimulation following Listeria monocytogenes infection.
22644879 2012 Interaction of IFN?R1 with TRAF6 regulates NF-?B activation and IFN?R1 stability.
22595141 2012 A novel internalization motif regulates human IFN-? R1 endocytosis.
22564607 2012 Monocyte-derived CD40 expression is regulated by interferon-?/interferon-? receptor-1 pathway when acting as a bridge during their interaction with T cells and allogeneic endothelial cells.
21859832 2011 Interferon-signaling pathway: associations with colon and rectal cancer risk and subsequent survival.
21731057 2011 Initial interrogation, confirmation and fine mapping of modifying genes: STAT3, IL1B and IFNGR1 determine cystic fibrosis disease manifestation.
21722521 2011 [Effects of CD74 gene on IFN?R gene expression in MG TEC].
21460021 2011 Interferon-gamma receptor-1 gene promoter polymorphisms and susceptibility to leprosy in children of a single family.
21221749 2011 Clinical and host genetic characteristics of Mendelian susceptibility to mycobacterial diseases in Japan.
21190998 2011 IL-29 and IFN? differ in their ability to modulate IL-12 production by TLR-activated human macrophages and exhibit differential regulation of the IFN? receptor expression.
20980339 2011 Hepatitis B viraemia: its heritability and association with common genetic variation in the interferon gamma signalling pathway.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20799037 2011 Gene-gene interaction between tuberculosis candidate genes in a South African population.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20500698 2010 Analysis of functional SNP in ifng/ifngr1 in Chinese Han population with tuberculosis.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20412699 Lack of association between IFNGR1 gene polymorphisms and biopsy-proven giant cell arteritis.
20399512 2010 Nontuberculous mycobacterial cervicofacial lymphadenitis in children from the multicenter, randomized, controlled trial in The Netherlands: relevance of polymorphisms in candidate host immunity genes.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20196868 2010 Polymorphisms in IL-1beta, vitamin D receptor Fok1, and Toll-like receptor 2 are associated with extrapulmonary tuberculosis.
20070287 2010 Contribution of interferon-gamma receptor 1 gene polymorphisms to pre-eclampsia in China.
20055726 2010 Interferon-gamma gene and interferon-gamma receptor-1 gene polymorphisms in children with tuberculosis from Turkey.
20015550 2010 Functional analysis of naturally occurring amino acid substitutions in human IFN-gammaR1.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19739012 2009 Urinary evaluation of the balance between the soluble interferon-gamma receptor (IFN-gammaR1) and the interleukin-4 receptor (IL-4Ralpha) in children with vesicoureteral reflux.
19734231 2009 SOCS-1 binding to tyrosine 441 of IFN-gamma receptor subunit 1 contributes to the attenuation of IFN-gamma signaling in vivo.
19723394 2009 Association of SLC11A1 with tuberculosis and interactions with NOS2A and TLR2 in African-Americans and Caucasians.
19712753 2009 IFNGR1 polymorphisms in Thai malaria patients.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19681704 2009 Refractory disseminated coccidioidomycosis and mycobacteriosis in interferon-gamma receptor 1 deficiency.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19575238 2009 NOS2A, TLR4, and IFNGR1 interactions influence pulmonary tuberculosis susceptibility in African-Americans.
19488747 2009 A regulatory polymorphism in interferon-gamma receptor 1 promoter is associated with the susceptibility to chronic hepatitis B virus infection.
19279332 2009 HIV-1 transactivator protein induction of suppressor of cytokine signaling-2 contributes to dysregulation of IFN{gamma} signaling.
19269302 2009 Down modulation of IFN-gamma signaling in alveolar macrophages isolated from smokers.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19172849 Transcriptional activity of interferon gamma and two subunits of its receptor as molecular markers of myocarditis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
18953482 2008 Polymorphisms of interferons and their receptors in the genetics of severe RSV-associated diseases.
18931463 2008 Lack of association between cytokine gene polymorphisms and silicosis and pulmonary tuberculosis in Chinese iron miners.
18809513 2008 Urinary evaluation of the balance between soluble interferon-gamma receptor (IFN-gammaR1) and interleukin-4 receptor (IL-4Ralpha).
18702743 2008 Interferon gamma receptor 1 gene polymorphism in patients with tuberculosis in China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18620489 2008 Interferon-gamma receptors in HIV-1 infection.
18593809 2008 The interferon gamma receptor 1 (IFNGR1) -56C/T gene polymorphism is associated with increased risk of early gastric carcinoma.
18555234 2009 Inverse regulation of the interferon-gamma receptor and its signaling in human endometrial stromal cells during decidualization.
18548239 2008 Relationships between specific serum IgE, IgG, IFN-gamma level and IFN-gamma, IFNR1 polymorphisms in patients with penicillin allergy.
18414508 2008 Frequent mutations in the 3'-untranslated region of IFNGR1 lack functional impairment in microsatellite-unstable colorectal tumours.
18287876 2008 Genetic polymorphisms in mediators of inflammation and gastric precancerous lesions.
17986123 2007 Polymorphisms of interferon-gamma and interferon-gamma receptor 1 genes and pulmonary tuberculosis in Koreans.
17697357 2007 Influence of IFN-gamma and its receptors in human breast cancer.
17618444 2007 The interferon-gamma receptor gene polymorphisms (Val14Met and Gln64Arg) are not associated with systemic lupus erythematosus in Chinese patients.
17572155 2007 GvHD-associated cytokine polymorphisms do not associate with Omenn syndrome rather than T-B- SCID in patients with defects in RAG genes.
17546485 2007 Transcriptional activity of genes encoding interferon gamma (IFNgamma) and its receptor assessed in peripheral blood mononuclear cells in patients with cardiac syndrome X.
17513528 2007 The novel IFNGR1 mutation 774del4 produces a truncated form of interferon-gamma receptor 1 and has a dominant-negative effect on interferon-gamma signal transduction.
17477815 2007 Polymorphisms in proinflammatory genes and susceptibility to typhoid fever and paratyphoid fever.
17431682 2007 Linkage and association analysis of candidate genes for TB and TNFalpha cytokine expression: evidence for association with IFNGR1, IL-10, and TNF receptor 1 genes.
17392024 2007 Association of polymorphisms in IL-12/IFN-gamma pathway genes with susceptibility to pulmonary tuberculosis in Indonesia.
17348823 2007 Genetic polymorphisms of inflammatory cytokines and liver fibrosis progression due to recurrent hepatitis C.
17339358 2007 Modulation of gamma interferon receptor 1 by Mycobacterium tuberculosis: a potential immune response evasive mechanism.
17251453 2007 Genetic polymorphisms in the promoter of the interferon gamma receptor 1 gene are associated with atopic cataracts.
17166914 2007 Downregulation of gamma interferon receptor 1 by Kaposi's sarcoma-associated herpesvirus K3 and K5.
17152005 2007 Associations between measles vaccine immunity and single-nucleotide polymorphisms in cytokine and cytokine receptor genes.
17136124 2007 IFNG and IFNGR1 gene polymorphisms and susceptibility to post-kala-azar dermal leishmaniasis in Sudan.
17030574 2006 Up-regulation of gamma interferon receptor expression due to Chlamydia-toll-like receptor interaction does not enhance signal transducer and activator of transcription 1 signaling.
17023216 2007 Polymorphisms of interferon-gamma and interferon-gamma receptor 1 genes and non-tuberculous mycobacterial lung diseases.
16944293 2006 Genetic polymorphism of interferon-gamma, interferon-gamma receptor, and interferon regulatory factor-1 genes in patients with hepatitis B virus infection.
16867043 2006 IL-10 promoter and IL4-Ralpha gene SNPs are associated with immediate beta-lactam allergy in atopic women.
16785527 2006 IFN-gamma and its receptor subunit IFNGR1 are recruited to the IFN-gamma-activated sequence element at the promoter site of IFN-gamma-activated genes: evidence of transactivational activity in IFNGR1.
16690980 2006 Polymorphism within the interferon-gamma/receptor complex is associated with pulmonary tuberculosis.
16563189 2006 IFNGR1 single nucleotide polymorphisms in rheumatoid arthritis.
16491350 2006 Associations of the IL2Ralpha, IL4Ralpha, IL10Ralpha, and IFN (gamma) R1 cytokine receptor genes with AIDS progression in a French AIDS cohort.
16476014 2006 Interferon-gamma receptor-1 gene promoter polymorphisms (G-611A; T-56C) and susceptibility to tuberculosis.
16233916 2006 Lack of association between interferon-gamma receptor-1 polymorphism and pulmonary TB in Iranian population sample.
16115485 2005 Interferon-gamma and interferon-gamma receptor 1 and 2 gene polymorphisms and restenosis following coronary stenting.
15952126 2005 [Polymorphisms within the interferon-Gamma receptor associated with systemic lupus erythematosus].
15780933 2005 Structural bases of unphosphorylated STAT1 association and receptor binding.
15756299 2005 Schistosomal hepatic fibrosis and the interferon gamma receptor: a linkage analysis using single-nucleotide polymorphic markers.
15527154 2004 Functional and genetic assessment of IFN-gamma receptor in patients with clinical tuberculosis.
15522878 2005 Role of tyrosine 441 of interferon-gamma receptor subunit 1 in SOCS-1-mediated attenuation of STAT1 activation.
15494521 2004 Rac1 contributes to maximal activation of STAT1 and STAT3 in IFN-gamma-stimulated rat astrocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15207788 2004 Interferon-gamma receptor 1 promoter polymorphisms: population distribution and functional implications.
15182327 2004 Polymorphisms in the genes encoding interferon-gamma and interferon-gamma receptors in multiple sclerosis.
15047947 2004 No association between interferon-gamma receptor-1 gene polymorphism and pulmonary tuberculosis in a Gambian population sample.
15004750 2004 Association between IFNA genotype and the risk of sarcoidosis.
14763782 2003 Polymorphisms in an interferon-gamma receptor-1 gene marker and susceptibility to periodontitis.
14734726 2004 Effect of chronic viral infection on epitope selection, cytokine production, and surface phenotype of CD8 T cells and the role of IFN-gamma receptor in immune regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12851715 2003 A novel single-nucleotide substitution, Leu 467 Pro, in the interferon-gamma receptor 1 gene associated with allergic diseases.
12753505 2003 Interferon-gamma receptor-1 gene polymorphism in tuberculosis patients from Croatia.
12743658 2003 Missense mutations of the interleukin-12 receptor beta 1(IL12RB1) and interferon-gamma receptor 1 (IFNGR1) genes are not associated with susceptibility to lepromatous leprosy in Korea.
12543882 2003 Upregulation of MHC class II, interferon-alpha and interferon-gamma receptor protein expression in HIV-associated nephropathy.
12516030 2003 Genomewide linkage analysis identifies polymorphism in the human interferon-gamma receptor affecting Helicobacter pylori infection.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454749 2002 Expression profiling of B cell chronic lymphocytic leukemia suggests deficient CD1-mediated immunity, polarized cytokine response, altered adhesion and increased intracellular protein transport and processing of leukemic cells.
12438563 2002 Seeing the light: preassembly and ligand-induced changes of the interferon gamma receptor complex in cells.
12244188 2002 Divergent role for TNF-alpha in IFN-gamma-induced killing of Toxoplasma gondii and Salmonella typhimurium contributes to selective susceptibility of patients with partial IFN-gamma receptor 1 deficiency.
12165521 2002 Lipid microdomains are required sites for the selective endocytosis and nuclear translocation of IFN-gamma, its receptor chain IFN-gamma receptor-1, and the phosphorylation and nuclear translocation of STAT1alpha.
12133952 2002 Two distinct domains within the N-terminal region of Janus kinase 1 interact with cytokine receptors.
12034035 2002 IFN-gamma downregulates interleukin-4 functional activity on monocytes by multiple mechanisms.
12020266 2002 Contribution of the interleukin 4 gene to susceptibility to subacute sclerosing panencephalitis.
11857344 2002 Requirement for both IL-12 and IFN-gamma signaling pathways in optimal IFN-gamma production by human T cells.
11585785 2001 Antiviral actions of interferons.
11438544 2001 Roles of phosphatidylinositol 3-kinase in interferon-gamma-dependent phosphorylation of STAT1 on serine 727 and activation of gene expression.
11240951 2001 Association of IFN-gamma and IFN regulatory factor 1 polymorphisms with childhood atopic asthma.
11139207 2001 A point mutation in a domain of gamma interferon receptor 1 provokes severe immunodeficiency.
10986460 2000 Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.
10811850 2000 In a novel form of IFN-gamma receptor 1 deficiency, cell surface receptors fail to bind IFN-gamma.
10192386 1999 A human IFNGR1 small deletion hotspot associated with dominant susceptibility to mycobacterial infection.
10022928 1999 Shp-2 tyrosine phosphatase functions as a negative regulator of the interferon-stimulated Jak/STAT pathway.
9389728 1997 Partial interferon-gamma receptor 1 deficiency in a child with tuberculoid bacillus Calmette-Guérin infection and a sibling with clinical tuberculosis.
9367779 1997 Neutralizing epitopes on the extracellular interferon gamma receptor (IFNgammaR) alpha-chain characterized by homolog scanning mutagenesis and X-ray crystal structure of the A6 fab-IFNgammaR1-108 complex.
9112336 1997 Interferon-gamma induces biosynthesis of complement components C2, C4 and factor H by human proximal tubular epithelial cells.
8960475 1996 Interferon-gamma-receptor deficiency in an infant with fatal bacille Calmette-Guérin infection.
8960473 1996 A mutation in the interferon-gamma-receptor gene and susceptibility to mycobacterial infection.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8662591 1996 Differential activation of acute phase response factor/STAT3 and STAT1 via the cytoplasmic domain of the interleukin 6 signal transducer gp130. I. Definition of a novel phosphotyrosine motif mediating STAT1 activation.
8631301 1996 Kinase-negative mutants of JAK1 can sustain interferon-gamma-inducible gene expression but not an antiviral state.
8500521 1993 Modulation of interferon-gamma receptor during human T lymphocyte alloactivation.
8456300 1993 Multiple defects of immune cell function in mice with disrupted interferon-gamma genes.
8443182 1993 Alignment of disulfide bonds of the extracellular domain of the interferon gamma receptor and investigation of their role in biological activity.
8156998 1994 Ligand-induced IFN gamma receptor tyrosine phosphorylation couples the receptor to its signal transduction system (p91).
8136357 1994 Human, mouse, and rat calnexin cDNA cloning: identification of potential calcium binding motifs and gene localization to human chromosome 5.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7673114 1995 Interaction between the components of the interferon gamma receptor complex.
7617032 1995 Crystal structure of a complex between interferon-gamma and its soluble high-affinity receptor.
7615558 1995 The Jak kinases differentially associate with the alpha and beta (accessory factor) chains of the interferon gamma receptor to form a functional receptor unit capable of activating STAT transcription factors.
7514165 1994 Interferon-gamma induces tyrosine phosphorylation of interferon-gamma receptor and regulated association of protein tyrosine kinases, Jak1 and Jak2, with its receptor.
7499845 1995 Identification of IFN-gamma receptor binding sites for JAK2 and enhancement of binding by IFN-gamma and its C-terminal peptide IFN-gamma(95-133).
2971451 1988 Molecular cloning and expression of the human interferon-gamma receptor.
2954953 1987 The human interferon-gamma receptor. Purification, characterization, and preparation of antibodies.
2532616 1989 Human interferon gamma receptor 1 (IFNGR1) gene maps to chromosome region 6q23-6q24.
1826725 1991 High-affinity receptor for interferon-gamma (IFN-gamma), a ubiquitous protein occurring in different molecular forms on human cells: blood monocytes and eleven different cell lines have the same IFN-gamma receptor protein.