Property Summary

NCBI Gene PubMed Count 52
Grant Count 133
R01 Count 86
Funding $8,580,545.78
PubMed Score 772.01
PubTator Score 61.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute quadriplegic myopathy 1.001 0.000

Synonym

Accession P15173 Q53XW6
Symbols MYF4
myf-4
bHLHc3

Gene

Gene RIF (25)

PMID Text
26563778 Findings indicate a interplay between A-kinase anchoring protein 6 (AKAP6) and myogenin.
25044114 results indicate that myogenin is a positive regulator in transcriptional regulation of MEGF10 in skeletal muscle
24577092 Sustained GSK3beta activity represses a critical regulatory step in the myogenic cascade, contributing to the undifferentiated, proliferative phenotype in alveolar rhabdomyosarcoma.
24215591 Data indicate that muscle MYOG mRNA expression doubled, whereas MSTN protein expression decreased following immobilization.
23944986 Our study illustrates that focal myogenin immunoreactivity occurs uncommonly in fibroepithelial polyps of the lower female genital tract.
23364797 the FACT complex promotes myogenin-dependent transcription
23226416 SREBP-1 regulate muscle protein synthesis through the downregulation of the expression of MYOD1, MYOG and MEF2C factors.
21672341 Human muscle samples were analysed at different time-points post-denervation to evaluate changes in myogenin expression and their relationship with skeletal muscle atrophy.
20213728 The physical interaction of CARM1 and PCAF is likely pivotal for the activation of PCAF in the downstream of CARM1 pathway for inducing myogenin under Tetradecanoylphorbol Acetate -induced differentiation.
19961777 After 2 years of denervation, expression of myogenin protein in myonuclei was decreased, but after 3 years of denervation, no expression of myogenin protein in myonuclei was found in denervated posterior cricoarytenoid muscles.
More...

AA Sequence

MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWAC      1 - 70
KVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN     71 - 140
QEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITV    141 - 210
EDVSVAFPDETMPN                                                            211 - 224
//

Text Mined References (53)

PMID Year Title
26563778 2015 AKAP6 inhibition impairs myoblast differentiation and muscle regeneration: Positive loop between AKAP6 and myogenin.
25416956 2014 A proteome-scale map of the human interactome network.
25044114 2014 Myogenin is a positive regulator of MEGF10 expression in skeletal muscle.
24860983 2014 Muscle lim protein isoform negatively regulates striated muscle actin dynamics and differentiation.
24577092 2014 Glycogen synthase kinase 3? represses MYOGENIN function in alveolar rhabdomyosarcoma.
24215591 2014 Muscle disuse atrophy is not accompanied by changes in skeletal muscle satellite cell content.
23944986 2013 Myogenin expression in vulvovaginal spindle cell lesions: analysis of a series of cases with an emphasis on diagnostic pitfalls.
23364797 2013 Myogenin recruits the histone chaperone facilitates chromatin transcription (FACT) to promote nucleosome disassembly at muscle-specific genes.
23226416 2012 SREBP-1 transcription factors regulate skeletal muscle cell size by controlling protein synthesis through myogenic regulatory factors.
21672341 2011 The study of myogenin expression in denervated human skeletal muscles.
More...