Property Summary

NCBI Gene PubMed Count 39
PubMed Score 21.57
PubTator Score 23.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
Multiple myeloma 1.876 1.2e-03
astrocytoma 1.600 2.4e-03
ependymoma 1.200 1.4e-02
oligodendroglioma 1.800 1.8e-03
osteosarcoma -1.221 3.8e-02
group 4 medulloblastoma 1.600 2.2e-02
glioblastoma 1.600 2.9e-03
medulloblastoma, large-cell 1.400 6.3e-04
hereditary spastic paraplegia -1.114 2.1e-02
acute quadriplegic myopathy 1.322 2.5e-06
primary pancreatic ductal adenocarcinoma 1.007 8.3e-03
tuberculosis -1.300 2.7e-07
non-small cell lung cancer -1.808 9.3e-18
intraductal papillary-mucinous adenoma (... 1.500 4.5e-03
intraductal papillary-mucinous carcinoma... 1.600 5.3e-03
lung cancer -1.200 4.3e-03
cystic fibrosis -1.200 6.9e-04
pediatric high grade glioma 1.100 9.3e-07
non primary Sjogren syndrome sicca -1.100 1.4e-02
aldosterone-producing adenoma -1.235 4.9e-02
psoriasis 1.200 1.6e-42
lung adenocarcinoma 1.277 1.5e-07
breast carcinoma 1.500 1.0e-27
Pick disease 1.300 3.0e-04
progressive supranuclear palsy 1.300 4.6e-03
ductal carcinoma in situ 1.100 1.4e-04
invasive ductal carcinoma 1.400 8.6e-05
ovarian cancer 2.400 5.7e-06

Gene RIF (19)

PMID Text
26503584 GAB2, GSPT1, TFDP2 and ZFPM1 are four new susceptibility loci for testicular germ cell tumor.
25028095 Overexpression of ID1 in two different cell lines induced STMN3 and GSPT1 at the transcriptional level, while depletion of ID1 reduced their expression.
24569073 The proteolytic cleavage of eRF3a and eRF3b into p-eRF3 leads to release an amino-terminal fragment containing nuclear export signal to allow the relocalization of eRF3 into the nucleus to interact with the p14ARF.
23377885 The survivin and eRF3 complex may function in spindle formation and segregation of chromosomes and cytokinesis.
23054082 ERF3 is targeted for caspase-mediated proteolytic cleavage and degradation during DNA damage-induced apoptosis.
23019593 A biological role for the overlapping ERF3 PAM2 motifs in the regulation of deadenylase accessibility to PABPC1 at the 3' end of poly(A).
22101789 Our results show that the presence of the longer allele of eRF3a is correlated with threefold increased risk of breast cancer development
20418951 crystal structures of the MLLE domain from PABPC1 in complex with the two PAM2 regions of eRF3
19963113 GSPT1 GGC(12) allele was present in 2.2% of colorectal cancer patients but was absent in Crohn disease patients and in the control group
19424636 eRF3a/GSPT1 12-GGC allele increases the susceptibility for breast cancer development.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18083835 eRF3a is degraded by the proteasome when not associated with eRF1; proteasomal degradation of eRF3a controls translation termination complex formation by adjusting the eRF3a level to that of eRF1.
17700517 GSTP1 inhibits the binding of MAP kinase kinase kinase 5 (MAP3K5) to the 14-3-3 protein, a MAP3K5 inhibitor, while a novel role of GSPT1 is revealed in the regulation of apoptosis signal-regulating kinase 1 (ASK1)-mediated apoptosis.
17562865 These results strongly suggest that the G1 arrest and the decrease in translation induced by eRF3a depletion are due to the inhibition of mTOR activity and hence that eRF3a belongs to the regulatory pathway of mTOR activity.
16452507 Further, we describe a novel complex that contains the NMD factors SMG-1 and Upf1, and the translation termination release factors eRF1 and eRF3 (SURF). an association between SURF and the EJC is required for SMG-1-mediated Upf1 phosphorylation and NMD.
15987998 eRF3a controls the formation of the termination complex by modulating eRF1 protein stability.
15987717 Polyglycine expansions in eukaryotic translation release factor 3 are associated with gastric cancer susceptibility
15908960 Human translation termination factor eRF3/GSPT1 is an interacting partner of RNase L.
12865429 GSPT1/eRF3 is proteolytically processed into an IAP-binding protein

AA Sequence

MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAP      1 - 70
KKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTV     71 - 140
EVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTA    141 - 210
GVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYI    211 - 280
GLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDD    281 - 350
VETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI    351 - 420
EEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGK    421 - 490
VLKLVPEKD                                                                 491 - 499
//

Text Mined References (43)

PMID Year Title
26503584 2015 Identification of four new susceptibility loci for testicular germ cell tumour.
25028095 2014 Nicotine-mediated invasion and migration of non-small cell lung carcinoma cells by modulating STMN3 and GSPT1 genes in an ID1-dependent manner.
24569073 2014 The processed isoform of the translation termination factor eRF3 localizes to the nucleus to interact with the ARF tumor suppressor.
23377885 2013 Polypeptide chain release factor eRF3 is a novel molecular partner of survivin.
23054082 2012 Translation termination factor eRF3 is targeted for caspase-mediated proteolytic cleavage and degradation during DNA damage-induced apoptosis.
23019593 2012 Biological role of the two overlapping poly(A)-binding protein interacting motifs 2 (PAM2) of eukaryotic releasing factor eRF3 in mRNA decay.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22101789 2012 GGCn polymorphism of eRF3a/GSPT1 gene and breast cancer susceptibility.
21269460 2011 Initial characterization of the human central proteome.
20418951 2010 Molecular basis of eRF3 recognition by the MLLE domain of poly(A)-binding protein.
19963113 2009 Differential expression of GSPT1 GGCn alleles in cancer.
19424636 2009 eRF3a/GSPT1 12-GGC allele increases the susceptibility for breast cancer development.
19417104 2009 SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18539146 2008 HemK2 protein, encoded on human chromosome 21, methylates translation termination factor eRF1.
18256688 2008 Interactions between UPF1, eRFs, PABP and the exon junction complex suggest an integrated model for mammalian NMD pathways.
18083835 2008 Proteasomal degradation of human release factor eRF3a regulates translation termination complex formation.
17700517 2008 G1 to S phase transition protein 1 induces apoptosis signal-regulating kinase 1 activation by dissociating 14-3-3 from ASK1.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17562865 2007 Human eukaryotic release factor 3a depletion causes cell cycle arrest at G1 phase through inhibition of the mTOR pathway.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16582619 2006 Identification of novel ARF binding proteins by two-hybrid screening.
16452507 2006 Binding of a novel SMG-1-Upf1-eRF1-eRF3 complex (SURF) to the exon junction complex triggers Upf1 phosphorylation and nonsense-mediated mRNA decay.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15987998 2005 Involvement of human release factors eRF3a and eRF3b in translation termination and regulation of the termination complex formation.
15987717 2005 Polyglycine expansions in eRF3/GSPT1 are associated with gastric cancer susceptibility.
15908960 2005 A newly discovered function for RNase L in regulating translation termination.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15326224 2004 The effect of eukaryotic release factor depletion on translation termination in human cell lines.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12865429 2003 The polypeptide chain-releasing factor GSPT1/eRF3 is proteolytically processed into an IAP-binding protein.
12489690 2002 Poly(A)-binding protein and eRF3 are associated in vivo in human and Xenopus cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10358005 1999 The eukaryotic polypeptide chain releasing factor (eRF3/GSPT) carrying the translation termination signal to the 3'-Poly(A) tail of mRNA. Direct association of erf3/GSPT with polyadenylate-binding protein.
9928949 1999 C-terminal domains of human translation termination factors eRF1 and eRF3 mediate their in vivo interaction.
9712840 1998 Molecular cloning of a novel member of the eukaryotic polypeptide chain-releasing factors (eRF). Its identification as eRF3 interacting with eRF1.
9620853 1998 The surveillance complex interacts with the translation release factors to enhance termination and degrade aberrant mRNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2841115 1988 A yeast gene required for the G1-to-S transition encodes a protein containing an A-kinase target site and GTPase domain.
2511002 1989 A human homologue of the yeast GST1 gene codes for a GTP-binding protein and is expressed in a proliferation-dependent manner in mammalian cells.
1574740 1992 Mapping of the human GSPT1 gene, a human homolog of the yeast GST1 gene, to chromosomal band 16p13.1.