Property Summary

NCBI Gene PubMed Count 39
Grant Count 5
Funding $673,283.7
PubMed Score 21.57
PubTator Score 23.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26503584 GAB2, GSPT1, TFDP2 and ZFPM1 are four new susceptibility loci for testicular germ cell tumor.
25028095 Overexpression of ID1 in two different cell lines induced STMN3 and GSPT1 at the transcriptional level, while depletion of ID1 reduced their expression.
24569073 The proteolytic cleavage of eRF3a and eRF3b into p-eRF3 leads to release an amino-terminal fragment containing nuclear export signal to allow the relocalization of eRF3 into the nucleus to interact with the p14ARF.
23377885 The survivin and eRF3 complex may function in spindle formation and segregation of chromosomes and cytokinesis.
23054082 ERF3 is targeted for caspase-mediated proteolytic cleavage and degradation during DNA damage-induced apoptosis.
23019593 A biological role for the overlapping ERF3 PAM2 motifs in the regulation of deadenylase accessibility to PABPC1 at the 3' end of poly(A).
22101789 Our results show that the presence of the longer allele of eRF3a is correlated with threefold increased risk of breast cancer development
20418951 crystal structures of the MLLE domain from PABPC1 in complex with the two PAM2 regions of eRF3
19963113 GSPT1 GGC(12) allele was present in 2.2% of colorectal cancer patients but was absent in Crohn disease patients and in the control group
19424636 eRF3a/GSPT1 12-GGC allele increases the susceptibility for breast cancer development.
More...

AA Sequence

MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAP      1 - 70
KKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTV     71 - 140
EVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTA    141 - 210
GVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYI    211 - 280
GLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDD    281 - 350
VETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI    351 - 420
EEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGK    421 - 490
VLKLVPEKD                                                                 491 - 499
//

Text Mined References (43)

PMID Year Title
26503584 2015 Identification of four new susceptibility loci for testicular germ cell tumour.
25028095 2014 Nicotine-mediated invasion and migration of non-small cell lung carcinoma cells by modulating STMN3 and GSPT1 genes in an ID1-dependent manner.
24569073 2014 The processed isoform of the translation termination factor eRF3 localizes to the nucleus to interact with the ARF tumor suppressor.
23377885 2013 Polypeptide chain release factor eRF3 is a novel molecular partner of survivin.
23054082 2012 Translation termination factor eRF3 is targeted for caspase-mediated proteolytic cleavage and degradation during DNA damage-induced apoptosis.
23019593 2012 Biological role of the two overlapping poly(A)-binding protein interacting motifs 2 (PAM2) of eukaryotic releasing factor eRF3 in mRNA decay.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22101789 2012 GGCn polymorphism of eRF3a/GSPT1 gene and breast cancer susceptibility.
21269460 2011 Initial characterization of the human central proteome.
20418951 2010 Molecular basis of eRF3 recognition by the MLLE domain of poly(A)-binding protein.
More...