Property Summary

NCBI Gene PubMed Count 24
Grant Count 127
R01 Count 45
Funding $41,569,663.54
PubMed Score 505.02
PubTator Score 110.98

Knowledge Summary

Patent

No data available

Synonym

Accession P15169 B1AP59 CPN
Symbols CPN
SCPN

Gene

PANTHER Protein Class (3)

PDB

2NSM  

Gene RIF (9)

PMID Text
23000409 CPN binds to fibrinogen and is present in a fibrin clot prepared from plasma.
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20648472 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
19010784 circulating CPN/CPB and platelets may potentially contribute to regulating the bioactivity of leukocyte chemoattractant chemerin
18940312 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18039526 This review summarizes the structure, enzymatic properties and function of this enzyme, including insights gained by the recent elucidation of the crystal structure of the CPN catalytic subunit and structural modeling of the non-catalytic 83 kDa subunit.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15718415 carboxypeptidase N regulates the biologic activity of SDF-1alpha by reducing the chemokine-specific activity

AA Sequence

MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPG      1 - 70
IHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQ     71 - 140
GPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFV    141 - 210
LSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGIT    211 - 280
NGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDEN    281 - 350
YNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIP    351 - 420
QVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA                                    421 - 458
//

Text Mined References (26)

PMID Year Title
23000409 2012 Binding of carboxypeptidase N to fibrinogen and fibrin.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20648472 2010 PNPLA3 variants specifically confer increased risk for histologic nonalcoholic fatty liver disease but not metabolic disease.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
19010784 2009 Regulation of chemerin bioactivity by plasma carboxypeptidase N, carboxypeptidase B (activated thrombin-activable fibrinolysis inhibitor), and platelets.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
18039526 2007 Structure and function of human plasma carboxypeptidase N, the anaphylatoxin inactivator.
More...