Property Summary

Ligand Count 9
NCBI Gene PubMed Count 24
PubMed Score 529.15
PubTator Score 110.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.713 9.6e-04

Gene RIF (9)

AA Sequence

MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPG      1 - 70
IHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQ     71 - 140
GPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFV    141 - 210
LSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGIT    211 - 280
NGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDEN    281 - 350
YNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIP    351 - 420
QVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA                                    421 - 458
//

Text Mined References (26)

PMID Year Title