Property Summary

NCBI Gene PubMed Count 92
Grant Count 481
R01 Count 349
Funding $36,180,913.23
PubMed Score 633.68
PubTator Score 218.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession P15153 Q9UDJ4
Symbols Gx
EN-7
HSPC022
p21-Rac2

Gene

PDB

1DS6   2W2T   2W2V   2W2X  

Gene RIF (49)

PMID Text
26867574 RAC1/RAC2 and SFK are proximal and essential for phosphatidylinositol 3-kinase (PI3K) activation in NK cell-mediated direct cytotoxicity against Cryptococcus neoformans.
26016997 RAC2 specifically interacted with a set of mitochondrial proteins.
25823784 our present analysis reinforces the involvement in ACT of the regulatory NADPH oxidase subunit RAC2 gene variant rs13058338 and, to a lesser extent of the CYBA gene variant rs4673.
25512081 homozygous loss-of-function RAC2 mutation in 2 patients with early-onset and progressive hypogammaglobulinemia(novel homozygous nonsense mutation in codon 56 (W56X)of RAC2 gene)
23875749 These studies imply functional importance of iNOS and its interaction with Rac2 in pathogen killing by the neutrophils.
23870057 p47(phox) and Rac2 accumulate only transiently at the phagosome at the onset of NADPH activity and detach from the phagosome before the end of reactive oxygen species production.
23850828 Mutations in hematopoiesis-specific Rho GTPases Rac2 and RhoH lead to a wide range of human blood disorders. (Review)
23591873 findings indicate that a chemokine-controlled pathway, consisting of Galphai2, ELMO1/Dock180, Rac1 and Rac2, regulates the actin cytoskeleton during breast cancer metastasis
23382236 study identified several missense mutations for RAC1 and RAC2, with some of the mutant proteins, including RAC1(P29S), RAC1(C157Y), RAC2(P29L), and RAC2(P29Q), being found to be activated and transforming; activating mutations of RAC GTPases were thus found in a wide variety of cancers at a low frequency
22411871 Rac2 GTPase alters mitochondrial membrane potential and electron flow through the mitochondrial respiratory chain complex III, generating high levels of reactive oxygen species in chronic-phase CML stem cells and primitive leukemia progenitor cells.
More...

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPL      1 - 70
SYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYP     71 - 140
QGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL                      141 - 192
//

Text Mined References (97)

PMID Year Title
26867574 2016 Ras-related C3 Botulinum Toxin Substrate (Rac) and Src Family Kinases (SFK) Are Proximal and Essential for Phosphatidylinositol 3-Kinase (PI3K) Activation in Natural Killer (NK) Cell-mediated Direct Cytotoxicity against Cryptococcus neoformans.
26016997 2015 Mitochondrial Dysfunction in Human Leukemic Stem/Progenitor Cells upon Loss of RAC2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823784 2015 Association of NADPH oxidase polymorphisms with anthracycline-induced cardiotoxicity in the RICOVER-60 trial of patients with aggressive CD20(+) B-cell lymphoma.
25512081 2015 RAC2 loss-of-function mutation in 2 siblings with characteristics of common variable immunodeficiency.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
23875749 2014 Interaction of inducible nitric oxide synthase with rac2 regulates reactive oxygen and nitrogen species generation in the human neutrophil phagosomes: implication in microbial killing.
23870057 2013 The recruitment of p47(phox) and Rac2G12V at the phagosome is transient and phosphatidylserine dependent.
More...