Property Summary

NCBI Gene PubMed Count 90
PubMed Score 2640.64
PubTator Score 308.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 2.9e-04
group 4 medulloblastoma -1.700 1.1e-04
malignant mesothelioma -1.500 5.3e-07
medulloblastoma, large-cell -1.200 2.0e-04
osteosarcoma -1.967 1.7e-09
Polycystic ovary syndrome -1.082 4.6e-03
psoriasis -2.400 9.2e-05

 GWAS Trait (1)

Gene RIF (57)

AA Sequence

MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG      1 - 70
ESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLR     71 - 140
VLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVP    141 - 210
SSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWS    211 - 280
TTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVL    281 - 350
GILVFLILLGIGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR       351 - 417
//

Text Mined References (95)

PMID Year Title