Property Summary

NCBI Gene PubMed Count 82
Grant Count 188
R01 Count 96
Funding $42,344,565.55
PubMed Score 2522.28
PubTator Score 308.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
psoriasis -2.400 0.000
osteosarcoma 2.021 0.000
group 4 medulloblastoma -1.700 0.000
medulloblastoma, large-cell -1.200 0.000
adult high grade glioma -1.200 0.000
Polycystic Ovary Syndrome -1.082 0.005

Synonym

Accession P15151 B4DTS9 P15152 Q15267 Q15268 Q96BJ1
Symbols PVS
HVED
CD155
NECL5
TAGE4
Necl-5

Gene

PVR

PANTHER Protein Class (1)

PDB

3UDW   1DGI   1NN8   3EPC   3EPD   3EPF   3J8F   3J9F   3URO   4FQP  

Gene RIF (59)

PMID Text
27049654 sCD155 levels were significantly decreased after surgical resection of cancers. Thus, sCD155 level in serum may be potentially useful as a biomarker for cancer development and progression
26842126 implying that TIGIT exerts immunosuppressive effects by competing with DNAM-1 for the same ligand, CD155
25972481 CD155 (PVR/Necl5) mediates a costimulatory signal in CD4+ T cells and regulates allergic inflammation.
25862891 CD155 may play a critical role through both immunological and non-immuno logical mechanisms in pancreatic cancer and may be a therapeutic target for this intractable malignancy.
25631086 The cell-surface receptor (Pvr) catalyzes a large structural change in the poliovirus that exposes membrane-binding protein chains.
25609078 The present study provides evidence that regulation of the PVR/CD155 DNAM-1 ligand expression by nitric oxide may represent an additional immune-mediated mechanism and supports the anti-myeloma activity of nitric oxide donors.
25320021 Our findings suggest that loss of CD155 expression may play an important role in the immune escape of HCC cells and thus CD155 may serve as a prognostic marker as well as a potential therapeutic target for HCC.
25209846 UPR decreases CD226 ligand CD155 expression and sensitivity to NK cell-mediated cytotoxicity in hepatoma cells.
25113908 Ala residues 10, 14 and 18 in the TM domain of Vpu are required for CD155 downregulation.
25113908 The Nef proteins from HIV-1 M NL4-3, SIVcpz EK505, and SIVgor CP2139 but not from SIVgsn 166, HIV-1 N CK1.62, and P RBF168, are capable of inducing cell surface downregulation of CD155
More...

AA Sequence

MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG      1 - 70
ESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLR     71 - 140
VLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVP    141 - 210
SSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWS    211 - 280
TTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVL    281 - 350
GILVFLILLGIGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR       351 - 417
//

Text Mined References (87)

PMID Year Title
27049654 2016 Increased Soluble CD155 in the Serum of Cancer Patients.
26842126 2016 Immunoreceptor TIGIT inhibits the cytotoxicity of human cytokine-induced killer cells by interacting with CD155.
25972481 2015 CD155 (PVR/Necl5) mediates a costimulatory signal in CD4+ T cells and regulates allergic inflammation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862891 2015 Clinical significance of CD155 expression in human pancreatic cancer.
25631086 2015 Nectin-like interactions between poliovirus and its receptor trigger conformational changes associated with cell entry.
25609078 2015 Nitric oxide donors increase PVR/CD155 DNAM-1 ligand expression in multiple myeloma cells: role of DNA damage response activation.
25416956 2014 A proteome-scale map of the human interactome network.
25320021 2015 Loss of CD155 expression predicts poor prognosis in hepatocellular carcinoma.
25209846 2014 UPR decreases CD226 ligand CD155 expression and sensitivity to NK cell-mediated cytotoxicity in hepatoma cells.
More...