Property Summary

NCBI Gene PubMed Count 124
Grant Count 116
R01 Count 73
Funding $18,815,708.14
PubMed Score 1759.87
PubTator Score 1147.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P15144 Q16728 Q6GT90 Q8IUK3 Q8IVH3 Q9UCE0 AP-N
Symbols APN
CD13
LAP1
P150
PEPN
GP150

Gene

PANTHER Protein Class (3)

PDB

4FYQ   4FYR   4FYS   4FYT  

 GWAS Trait (1)

Gene RIF (83)

PMID Text
26771355 Data show that CD13 anntigen and receptor tyrosine kinase-like orphan receptor 2 (ROR2) identify a cardiac lineage precursor pool that is capable of successful engraftment into the porcine heart.
26514774 Alanyl aminopeptidase expression is confined to mature zymogenic chief cells and its expression is lost en route to metaplasia.
26449746 Data indicate that fluorogenic substrates can be successfully used to identify aminopeptidase N and to measure their activity in cell lysates.
26311161 The substrate Angiotensin II, the enzymes aminopeptidases-A, B, M as well as IRAP were detected in the jejunal mucosa.
26208633 14-3-3epsilon might directly bind to CD13, which transmits its signal in chondrocytes to induce a catabolic phenotype similar to that observed in osteoarthritis.
25929234 Aminopeptidase N activity in tissue and plasma from colorectal cancer patients is an independent prognostic factor of 5-year survival.
25885470 We identified a unique HCC line, Li-7, which not only shows heterogeneity for a CD13(+) CSC hierarchy, but also undergoes a "population change" upon CSC differentiation
25879366 Expression of APN/CD13 is a potential unfavorable factor to predict the efficacy and prognosis of post-operative chemotherapy in NSCLC patients, especially in lung adenocarcinoma patients.
25461922 This study permitted the identification of the novel human LAP1C isoform and partially unraveled the molecular basis of LAP1 regulation.
25340499 Together these experiments reveal potential enzymatic and signalling roles for APN in osteosarcoma and establish a starting point for an in-depth analysis of the role of APN in regulating invasiveness.
More...

AA Sequence

MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKA      1 - 70
WNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLR     71 - 140
GVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATT    141 - 210
QMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLL    211 - 280
AFIVSEFDYVEKQASNGVLIRIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFN    281 - 350
AGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL    351 - 420
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSF    421 - 490
LSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGT    491 - 560
LSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDYWLIDVRAQNDLFSTSGNEWVLLNLNVTGYY    561 - 630
RVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALS    631 - 700
SLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEE    701 - 770
MVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI    771 - 840
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFS    841 - 910
TEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK                 911 - 967
//

Text Mined References (129)

PMID Year Title
26771355 2016 CD13 and ROR2 Permit Isolation of Highly Enriched Cardiac Mesoderm from Differentiating Human Embryonic Stem Cells.
26514774 2015 Identification of alanyl aminopeptidase (CD13) as a surface marker for isolation of mature gastric zymogenic chief cells.
26449746 2016 Activity profiling of aminopeptidases in cell lysates using a fluorogenic substrate library.
26311161 2015 Local expression of AP/AngIV/IRAP and effect of AngIV on glucose-induced epithelial transport in human jejunal mucosa.
26208633 2015 The pro-inflammatory cytokine 14-3-3? is a ligand of CD13 in cartilage.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25929234 2015 Aminopeptidase N activity predicts 5-year survival in colorectal cancer patients.
25885470 2015 Identification of a unique hepatocellular carcinoma line, Li-7, with CD13(+) cancer stem cells hierarchy and population change upon its differentiation during culture and effects of sorafenib.
25879366 Expression and clinical significance of aminopeptidase N/CD13 in non-small cell lung cancer.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
More...