Property Summary

NCBI Gene PubMed Count 144
Grant Count 322
R01 Count 181
Funding $53,082,759.47
PubMed Score 1850.97
PubTator Score 343.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
astrocytoma 1.500 0.015
glioblastoma 1.600 0.003
intraductal papillary-mucinous carcinoma... -1.300 0.030
ulcerative colitis 1.900 0.000
ovarian cancer -1.400 0.003

Synonym

Accession P15121 B2R8N3 Q5U031 Q6FGA4 Q6ICP2 Q9BS21 Q9UCI9 AR
Symbols AR
ADR
ALR2
ALDR1

Gene

PANTHER Protein Class (2)

PDB

1ABN   1ADS   1AZ1   1AZ2   1EF3   1EL3   1IEI   1MAR   1PWL   1PWM   1T40   1T41   1US0   1X96   1X97   1X98   1XGD   1Z3N   1Z89   1Z8A   2ACQ   2ACR   2ACS   2ACU   2AGT   2DUX   2DUZ   2DV0   2F2K   2FZ8   2FZ9   2FZB   2FZD   2HV5   2HVN   2HVO   2I16   2I17   2IKG   2IKH   2IKI   2IKJ   2INE   2INZ   2IPW   2IQ0   2IQD   2IS7   2ISF   2J8T   2NVC   2NVD   2PD5   2PD9   2PDB   2PDC   2PDF   2PDG   2PDH   2PDI   2PDJ   2PDK   2PDL   2PDM   2PDN   2PDP   2PDQ   2PDU   2PDW   2PDX   2PDY   2PEV   2PF8   2PFH   2PZN   2QXW   2R24   3BCJ   3DN5   3G5E   3GHR   3GHS   3GHT   3GHU   3LBO   3LD5   3LEN   3LEP   3LQG   3LQL   3LZ3   3LZ5   3M0I   3M4H   3M64   3MB9   3MC5   3ONB   3ONC   3P2V   3Q65   3Q67   3RX2   3RX3   3RX4   3S3G   3T42   3U2C   3V35   3V36   4GCA   4GQ0   4IGS   4JIR   4LAU   4LAZ   4LB3   4LB4   4LBR   4LBS   4NKC   4PR4   4PRR   4PRT   4PUU   4PUW   4Q7B   4QBX   4QR6   4QX4   4QXI   4RPQ   4XZH   4XZI   4YS1   4YU1  

Gene RIF (100)

PMID Text
25885804 Meta-analysis shows that the AR rs759853 polymorphism may correlate with the susceptibility of DN. However, data do not support the association between this DNA variation and the progression of DN.
25722213 ALR C(-106)T polymorphism was not associated with an increased risk of Diabetic Retinopathy; subgroup analysis showed a genetic association between ALR C(-106)T polymorphism and the risk of Diabetic Retinopathy of type 1 Diabetes but not Diabetic Retinopathy of type 2 Diabetes(Meta-Analysis)
25528584 L-idose is the best alternative to D-glucose in studies on aldose reductase.
25446850 Higher expression of PLA2G2A, PTGS2, AKR1B1, AKR1C3 and ABCC4 was seen in 22-B endometriosis cells.
25123395 Data conclude that AKR1B1 and TM6SF1 may serve as candidate methylation biomarkers for early breast cancer detection.
24698671 Aldose reductase gene may not be significantly associated with diabetic retinopathy in Chinese patients with type 2 diabetes mellitus.
24663124 role of the human aldose reductase AKR1B1 in prostaglandin (PG) F2 alpha synthesis in human subcutaneous and omental adipose tissue
24567419 One of the most striking changes involved sorbitol dehydrogenase, a key enzyme in the polyol pathway. Validation studies revealed dramatically increased sorbitol dehydrogenase concentrations and activity in adenomas and cancer cell lines, along with important changes in the expression of other enzymes in the same (AKR1B1) and related (KHK) pathways.
24474649 Aldose reductase contributes to diabetes-mediated mitochondrial dysfunction and damage through the activation of p53.
24360973 In type 2 diabetic patients with suboptimal glycaemic control, the z-4 allele of ALR2 (CA)n polymorphism was independently associated with increased susceptibility to cataracts.
More...

AA Sequence

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR      1 - 70
EELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILD     71 - 140
TWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAY    141 - 210
SPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE    211 - 280
LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF                                      281 - 316
//

Text Mined References (152)

PMID Year Title
25885804 2015 Is rs759853 polymorphism in promoter of aldose reductase gene a risk factor for diabetic nephropathy? A meta-analysis.
25722213 2015 The Relationship Between Aldose Reductase C106T Polymorphism and Diabetic Retinopathy: An Updated Meta-Analysis.
25528584 2015 L-Idose: an attractive substrate alternative to D-glucose for measuring aldose reductase activity.
25446850 2015 Expression of AKR1B1, AKR1C3 and other genes of prostaglandin F2? biosynthesis and action in ovarian endometriosis tissue and in model cell lines.
25123395 2014 Validation of DNA promoter hypermethylation biomarkers in breast cancer--a short report.
24698671 2014 Association of C(-106)T polymorphism in aldose reductase gene with diabetic retinopathy in Chinese patients with type 2 diabetes mellitus.
24663124 2014 Prostaglandin (PG) F2 alpha synthesis in human subcutaneous and omental adipose tissue: modulation by inflammatory cytokines and role of the human aldose reductase AKR1B1.
24567419 2014 Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
24474649 2014 Aldose reductase-mediated phosphorylation of p53 leads to mitochondrial dysfunction and damage in diabetic platelets.
24360973 Additive effect of aldose reductase Z-4 microsatellite polymorphism and glycaemic control on cataract development in type 2 diabetes.
More...