Property Summary

Ligand Count 449
NCBI Gene PubMed Count 153
PubMed Score 1915.84
PubTator Score 343.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ulcerative colitis 1.900 1.9e-04
astrocytoma 1.500 1.5e-02
glioblastoma 1.600 2.7e-03
intraductal papillary-mucinous carcinoma... -1.300 3.0e-02
malignant mesothelioma -2.100 4.1e-08
ovarian cancer -1.400 2.5e-03

Synonym

Accession P15121 B2R8N3 Q5U031 Q6FGA4 Q6ICP2 Q9BS21 Q9UCI9 AR
Symbols AR
ADR
ALR2
ALDR1

Gene

PANTHER Protein Class (2)

PDB

1ABN   1ADS   1AZ1   1AZ2   1EF3   1EL3   1IEI   1MAR   1PWL   1PWM   1T40   1T41   1US0   1X96   1X97   1X98   1XGD   1Z3N   1Z89   1Z8A   2ACQ   2ACR   2ACS   2ACU   2AGT   2DUX   2DUZ   2DV0   2F2K   2FZ8   2FZ9   2FZB   2FZD   2HV5   2HVN   2HVO   2I16   2I17   2IKG   2IKH   2IKI   2IKJ   2INE   2INZ   2IPW   2IQ0   2IQD   2IS7   2ISF   2J8T   2NVC   2NVD   2PD5   2PD9   2PDB   2PDC   2PDF   2PDG   2PDH   2PDI   2PDJ   2PDK   2PDL   2PDM   2PDN   2PDP   2PDQ   2PDU   2PDW   2PDX   2PDY   2PEV   2PF8   2PFH   2PZN   2QXW   2R24   3BCJ   3DN5   3G5E   3GHR   3GHS   3GHT   3GHU   3LBO   3LD5   3LEN   3LEP   3LQG   3LQL   3LZ3   3LZ5   3M0I   3M4H   3M64   3MB9   3MC5   3ONB   3ONC   3P2V   3Q65   3Q67   3RX2   3RX3   3RX4   3S3G   3T42   3U2C   3V35   3V36   4GCA   4GQ0   4IGS   4JIR   4LAU   4LAZ   4LB3   4LB4   4LBR   4LBS   4NKC   4PR4   4PRR   4PRT   4PUU   4PUW   4Q7B   4QBX   4QR6   4QX4   4QXI   4RPQ   4XZH   4XZI   4YS1   4YU1   5HA7  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (109)

AA Sequence

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR      1 - 70
EELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILD     71 - 140
TWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAY    141 - 210
SPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE    211 - 280
LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF                                      281 - 316
//

Text Mined References (161)

PMID Year Title