Property Summary

NCBI Gene PubMed Count 69
PubMed Score 846.45
PubTator Score 511.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Acquired thrombocytopenia 7
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 7
Adrenogenital disorder 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 25
Allergic rhinitis 92
Angioedema 36
Ankylosing spondylitis 138
Articular gout 11
Aspiration pneumonitis 6
Asthma 349
Atopic dermatitis 944
Autoimmune disease 5
Autoimmune hemolytic anemia 17
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 28
Blepharoconjunctivitis 5
Bursitis 10
Cerebral edema 5
Congenital adrenal hyperplasia 74
Congenital hypoplastic anemia 8
Contact Dermatitis 80
Corneal abrasion 6
Corneal ulcer 9
Crohn's disease 304
Cyclitis 6
Dacryocystitis 7
Dermatitis herpetiformis 11
Diagnostic Test for Cushing's Syndrome 5
Discoid lupus erythematosus 7
Disorder of eye 7
Disorder of musculoskeletal system 5
Disorder of skin 5
Edema of larynx 5
Eosinophilic asthma 5
Epicondylitis 19
Eruption of skin 5
Erythema multiforme 15
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Extrinsic allergic alveolitis 6
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 5
Granuloma annulare 5
Herpes zoster keratitis 6
Hodgkin's disease 18
Humoral hypercalcemia of malignancy 6
Idiopathic thrombocytopenic purpura 5
Infective blepharitis 5
Inflammatory bowel disease 142
Iridocyclitis 12
Iritis 9
Juvenile rheumatoid arthritis 105
Keratitis 42
Lichen simplex chronicus 7
Löffler's syndrome 5
Meibomianitis 4
Miliary tuberculosis 5
Multiple Sclerosis 498
Mycosis fungoides 30
Nephrotic Syndrome 48
Non-Hodgkin's lymphoma 22
Ocular rosacea 4
Pemphigus 18
Plaque psoriasis 14
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 10
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 29
Progressive Diffuse Large B-Cell Lymphoma 4
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Punctate Epithelial Keratopathy 6
Rheumatic heart disease 8
Rheumatoid Arthritis 1171
Rosacea 18
Scalp psoriasis 6
Seborrheic dermatitis 19
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Stevens-Johnson syndrome 91
Superficial Ocular Infection 6
Sympathetic uveitis 4
Synovitis 72
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Tendinitis 13
Tenosynovitis 15
Thyroiditis 25
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protein reaction 5
Transplanted organ rejection 10
Uveitis 103
psoriasis 6685
sarcoidosis 368
systemic lupus erythematosus 172
ulcerative colitis 2087
Disease Target Count P-value
lung carcinoma 2844 2.3530201652991E-22
atypical teratoid/rhabdoid tumor 1095 1.92132128819508E-11
ependymoma 2514 1.96088438365727E-10
Breast cancer 3099 8.65195305154946E-8
medulloblastoma 1524 2.94905947723469E-7
lung adenocarcinoma 2714 3.11690895396458E-6
ovarian cancer 8492 5.68224850787307E-6
primitive neuroectodermal tumor 3031 4.22924907662625E-5
medulloblastoma, large-cell 6234 9.84322461056889E-5
Down syndrome 548 0.0018887309084093
pilocytic astrocytoma 3086 0.00209532953579703
adult high grade glioma 2148 0.00270564341242362
osteosarcoma 7933 0.0038360224040413
cutaneous lupus erythematosus 1056 0.00394790066742208
dermatomyositis 967 0.00530551162081841
adrenocortical carcinoma 1427 0.00592557451945
glioblastoma 5572 0.00751027715935322
active Crohn's disease 918 0.00797572366091277
astrocytic glioma 2241 0.0195598569009912
esophageal adenocarcinoma 737 0.0200190588680455
Gaucher disease type 1 171 0.0205819769512283
gastric carcinoma 832 0.0346848246219351
Multiple myeloma 1328 0.0389454043271293
chronic rhinosinusitis 512 0.0492370873661972

Expression

  Differential Expression (26)

Disease log2 FC p
gastric carcinoma -1.800 0.035
Multiple myeloma 1.946 0.039
astrocytic glioma -1.400 0.020
esophageal adenocarcinoma -1.900 0.020
psoriasis 3.200 0.000
cutaneous lupus erythematosus 1.600 0.004
osteosarcoma -1.310 0.004
ependymoma -2.400 0.000
glioblastoma -1.800 0.008
medulloblastoma -2.500 0.000
atypical teratoid/rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -3.000 0.000
adrenocortical carcinoma -1.103 0.006
active Crohn's disease 1.350 0.008
adult high grade glioma -1.900 0.003
pilocytic astrocytoma -1.500 0.002
lung adenocarcinoma -1.100 0.000
lung carcinoma -1.300 0.000
Breast cancer 1.600 0.000
ulcerative colitis 1.100 0.007
ovarian cancer -1.700 0.000
Gaucher disease type 1 -1.800 0.021
Down syndrome 2.000 0.002
chronic rhinosinusitis -1.316 0.049
dermatomyositis 1.200 0.005

Synonym

Accession P15104 Q499Y9 Q5T9Z1 Q7Z3W4 Q8IZ17 GS
Symbols GS
GLNS
PIG43
PIG59

Gene

PANTHER Protein Class (1)

PDB

2OJW   2QC8  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (39)

PMID Text
26990986 GS is acetylated at lysines 11 and 14, yielding a degron that is necessary and sufficient for binding and ubiquitylation by CRL4(CRBN) and degradation by the proteasome.
26836257 Studied molecular mechanisms of glutamine synthetase mutations that lead to clinically relevant pathologies.
26599579 This study demonstrated that Influence of glutamine synthetase gene polymorphisms on the development of hyperammonemia during valproic acid-based therapy.
26595383 Data show that glutamine synthetase (GS) produces glutamine (Gln) from tricarboxylic acid (TCA)-cycle-derived carbons.
26395743 GLUL rs10911021 is associated prospectively with adjudicated cardiovascular composite end points among overweight/obese individuals with type 2 diabetes.
25822763 Data indicate that the triple stain of reticulin, glypican-3, and glutamine synthetae is useful in the differentiation of hepatocellular carcinoma, hepatic adenoma, and focal nodular hyperplasia.
25677913 findings point to SNP rs10911021 of GLULas an independent modulator of mortality in patients with type 2 diabetes
23982368 through a 3-stage genome-wide association study in 4188 type 2 diabetic patients, identified a novel susceptibility locus for coronary heart disease in the region of the GLUL gene
23807780 Results highlight the diagnostic errors that can be caused by variant patterns of staining with glutamine synthetase and serum amyloid-associated protein in inflammatory hepatocellular adenoma and focal nodular hyperplasia.
23410662 High Glutamine synthetase expression is associated with epilepsy in newly diagnosed glioblastoma multiforme.
More...

AA Sequence

MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQS      1 - 70
EGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLM     71 - 140
GTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCE    141 - 210
GISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR    211 - 280
HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS    281 - 350
VTEALIRTCLLNETGDEPFQYKN                                                   351 - 373
//

Text Mined References (74)

PMID Year Title
26990986 2016 Glutamine Triggers Acetylation-Dependent Degradation of Glutamine Synthetase via the Thalidomide Receptor Cereblon.
26836257 2016 Molecular Mechanisms of Glutamine Synthetase Mutations that Lead to Clinically Relevant Pathologies.
26599579 2015 Influence of glutamine synthetase gene polymorphisms on the development of hyperammonemia during valproic acid-based therapy.
26595383 2015 Glutamine synthetase activity fuels nucleotide biosynthesis and supports growth of glutamine-restricted glioblastoma.
26395743 2016 Prospective Association of GLUL rs10911021 With Cardiovascular Morbidity and Mortality Among Individuals With Type 2 Diabetes: The Look AHEAD Study.
25822763 2015 A triple stain of reticulin, glypican-3, and glutamine synthetase: a useful aid in the diagnosis of liver lesions.
25677913 2015 Genetic Variant at the GLUL Locus Predicts All-Cause Mortality in Patients With Type 2 Diabetes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23982368 2013 Association between a genetic variant related to glutamic acid metabolism and coronary heart disease in individuals with type 2 diabetes.
More...