Property Summary

Ligand Count 60
NCBI Gene PubMed Count 194
PubMed Score 617.65
PubTator Score 404.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.241 4.9e-06
adrenocortical adenoma -2.487 2.5e-02
Atopic dermatitis -1.800 1.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.665 4.0e-03
Breast cancer -3.500 3.1e-02
breast carcinoma -2.500 2.0e-20
Duchenne muscular dystrophy 1.290 2.0e-06
ductal carcinoma in situ -2.900 1.2e-02
interstitial cystitis -1.500 4.1e-02
intraductal papillary-mucinous adenoma (... -2.900 2.6e-05
intraductal papillary-mucinous carcinoma... -3.500 7.2e-06
intraductal papillary-mucinous neoplasm ... -3.600 3.6e-04
invasive ductal carcinoma -2.499 6.6e-03
lung adenocarcinoma -4.000 1.1e-15
lung cancer -2.200 1.5e-05
lung carcinoma -5.000 1.1e-30
nephrosclerosis 1.734 5.5e-04
non primary Sjogren syndrome sicca 1.200 1.5e-02
non-small cell lung cancer -5.031 1.8e-25
osteosarcoma -3.685 5.3e-03
ovarian cancer -3.300 1.9e-15
periodontitis 1.500 7.3e-17
psoriasis -1.100 2.8e-02

Gene RIF (185)

AA Sequence

MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE      1 - 70
FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA             71 - 132
//

Text Mined References (200)

PMID Year Title