Property Summary

NCBI Gene PubMed Count 167
Grant Count 93
R01 Count 68
Funding $9,469,323.15
PubMed Score 545.42
PubTator Score 404.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P15090 Q6IBA1
Symbols aP2
ALBP
AFABP
A-FABP
HEL-S-104

Gene

PDB

1TOU   1TOW   2HNX   2NNQ   3FR2   3FR4   3FR5   3P6C   3P6D   3P6E   3P6F   3P6G   3P6H   3Q6L   3RZY   4NNS   4NNT   5D45   5D47   5D48   5D4A   5EDB   5EDC  

Gene RIF (158)

PMID Text
27089280 High FABP expression is associated with Sepsis.
26887419 Increased FABP4 level showed increased risk for reduced lung function in subjects with normal ventilatory function.
26823558 results underline a gender difference in FABP4 secretion in stable COPD patients.
26752184 Serum irisin might exert antagonistic effects on FABP4 in the middle-aged Chinese population.
26343611 These findings indicate that exogenous FABP4 interacts with plasma membrane proteins, specifically CK1.
26069234 Circulating FABP4 may prove useful as a prognostic biomarker in risk stratification of patients with acute coronary syndrome.
25958041 Our data suggest that FABP4 in glomerular mesangial cells is up-regulated in diabetic nephropathies and FABP4 mediates apoptosis via the ER stress in human mesangial cells.
25953897 we identify adipocyte-type fatty acid-binding protein (A-Fabp) and other members of the fatty acid-binding protein (Fabp) family as interaction partners of Cgi-58.
25923423 Biological network analysis of differentially regulated genes revealed that FABP4, ADIPOQ and RBP4 were most down regulated genes, sharing strong connection with the other molecules of lipid metabolism pathway.
25897794 FABP4 inhibition suppresses PPARgamma activity and VLDL-induced foam cell formation in IL-4-polarized human macrophages.
More...

AA Sequence

MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE      1 - 70
FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA             71 - 132
//

Text Mined References (173)

PMID Year Title
27089280 2016 Evaluation of New Diagnostic Biomarkers in Pediatric Sepsis: Matrix Metalloproteinase-9, Tissue Inhibitor of Metalloproteinase-1, Mid-Regional Pro-Atrial Natriuretic Peptide, and Adipocyte Fatty-Acid Binding Protein.
26887419 2016 The relationship between serum fatty-acid binding protein 4 level and lung function in Korean subjects with normal ventilatory function.
26823558 2016 Gender difference in plasma fatty-acid-binding protein 4 levels in patients with chronic obstructive pulmonary disease.
26752184 2016 Circulating Adipocyte Fatty Acid Binding Protein (FABP4) Levels Are Associated with Irisin in the Middle-Aged General Chinese Population.
26343611 2015 New insights into circulating FABP4: Interaction with cytokeratin 1 on endothelial cell membranes.
26069234 2015 Circulating FABP4 is a prognostic biomarker in patients with acute coronary syndrome but not in asymptomatic individuals.
25958041 2015 Fatty Acid-Binding Protein 4 mediates apoptosis via endoplasmic reticulum stress in mesangial cells of diabetic nephropathy.
25953897 2015 Fatty Acid-binding Proteins Interact with Comparative Gene Identification-58 Linking Lipolysis with Lipid Ligand Shuttling.
25923423 2015 Transcriptomics profiling study of breast cancer from Kingdom of Saudi Arabia revealed altered expression of Adiponectin and Fatty Acid Binding Protein4: Is lipid metabolism associated with breast cancer?
25897794 2015 FABP4 inhibition suppresses PPAR? activity and VLDL-induced foam cell formation in IL-4-polarized human macrophages.
More...