Property Summary

Ligand Count 34
NCBI Gene PubMed Count 16
PubMed Score 882.97
PubTator Score 187.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (5)

AA Sequence

MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFR      1 - 70
VKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYNKWETIEAWTQQVATENPALI     71 - 140
SRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKL    141 - 210
DFYVLPVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESE    211 - 280
KETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGP    281 - 350
GATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY       351 - 417
//

Text Mined References (16)

PMID Year Title