Property Summary

NCBI Gene PubMed Count 16
Grant Count 34
R01 Count 18
Funding $4,047,860.04
PubMed Score 854.19
PubTator Score 187.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26316592 This study showed that CPA2 and CPB1 variants are not associated with chronic pancreatitis.
25903579 These findings indicate unique pro-metastatic mechanisms in grade 1 tumors that can include up-regulation of CPB1, activation of NF-kappaB pathway and changes in cell survival and cytoskeleton.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18558717 The structure of the tick carboxypeptidase inhibitor (TCI) and its backbone dynamics, free and in complex with human carboxypeptidase B, have been determined by NMR spectroscopy.
17673703 TAFI and CPB modulate the plasminogen system both in the matrix and on the cell surface, thus leading to the inhibition of endothelial cell movement and tube formation.

AA Sequence

MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFR      1 - 70
VKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYNKWETIEAWTQQVATENPALI     71 - 140
SRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKL    141 - 210
DFYVLPVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESE    211 - 280
KETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGP    281 - 350
GATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY       351 - 417
//

Text Mined References (16)

PMID Year Title
26316592 2015 Variants in pancreatic carboxypeptidase genes CPA2 and CPB1 are not associated with chronic pancreatitis.
25903579 2015 Combined Proteomics and Transcriptomics Identifies Carboxypeptidase B1 and Nuclear Factor ?B (NF-?B) Associated Proteins as Putative Biomarkers of Metastasis in Low Grade Breast Cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18558717 2008 The NMR structure and dynamics of the two-domain tick carboxypeptidase inhibitor reveal flexibility in its free form and stiffness upon binding to human carboxypeptidase B.
17673703 2007 TAFI and pancreatic carboxypeptidase B modulate in vitro capillary tube formation by human microvascular endothelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12162965 2002 Human procarboxypeptidase B: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI).
9524066 1998 Comparative analysis of the sequences and three-dimensional models of human procarboxypeptidases A1, A2 and B.
8322019 1993 Isoforms of procarboxypeptidase B, (pancreas-specific protein, PASP) in human serum, pancreatic tissue and juice.
More...