Property Summary

NCBI Gene PubMed Count 17
Grant Count 16
R01 Count 16
Funding $1,376,901.74
PubMed Score 71.79
PubTator Score 177.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
23955596 mechanism by which CPA1 variants confer increased pancreatitis risk may involve misfolding-induced endoplasmic reticulum stress rather than elevated trypsin activity
21502183 Serum pro-CPA and CPA levels were increased in either pancreatitis or pancreatic malignancy
18566513 A description of the ternary complex hCPA1-Zn2+-poly(acrylic acid) is included as a model of the interaction of mucoadhesive polymers with proteases in the gastrointestinal tract.

AA Sequence

MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFP      1 - 70
SIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENP     71 - 140
HLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAIL    141 - 210
DTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFA    211 - 280
NSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNY    281 - 350
GSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHPY     351 - 419
//

Text Mined References (19)

PMID Year Title
24522117 2014 Genetics of pancreatitis: the 2014 update.
23955596 2013 Variants in CPA1 are strongly associated with early onset chronic pancreatitis.
21502183 2012 Serum procarboxypeptidase A and carboxypeptidase A levels in pancreatic disease.
21098023 2011 Chymotrypsin C is a co-activator of human pancreatic procarboxypeptidases A1 and A2.
19179285 2009 Mammalian metallopeptidase inhibition at the defense barrier of Ascaris parasite.
18566513 2008 Direct interaction between a human digestive protease and the mucoadhesive poly(acrylic acid).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...