Property Summary

NCBI Gene PubMed Count 182
PubMed Score 538.72
PubTator Score 2397.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.400 1.2e-04
Astrocytoma, Pilocytic 2.000 1.2e-09
atypical teratoid / rhabdoid tumor 1.300 3.6e-03
chronic rhinosinusitis -1.010 3.3e-02
ependymoma 1.400 9.0e-05
glioblastoma 1.600 2.9e-04
inflammatory breast cancer -1.200 2.2e-03
interstitial cystitis 1.100 8.7e-04
intraductal papillary-mucinous neoplasm ... 2.100 7.9e-04
lung cancer -2.800 3.2e-04
malignant mesothelioma -1.400 1.4e-05
pancreatic cancer 1.200 6.4e-04
pancreatic ductal adenocarcinoma liver m... 1.104 1.2e-02
pituitary cancer -1.100 7.3e-03
psoriasis -1.600 8.7e-65
subependymal giant cell astrocytoma 1.482 3.1e-02

Gene RIF (159)

AA Sequence

MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQ      1 - 70
GEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNAT     71 - 140
ADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF            141 - 202
//

Text Mined References (183)

PMID Year Title