Property Summary

NCBI Gene PubMed Count 23
PubMed Score 22.84
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.400 5.2e-04
astrocytoma -1.400 8.4e-03
atypical teratoid / rhabdoid tumor -1.600 1.1e-05
Breast cancer 2.300 3.1e-02
ependymoma -1.400 1.4e-06
glioblastoma -1.400 8.4e-05
lung carcinoma 1.200 3.0e-21
medulloblastoma -1.200 8.3e-04
medulloblastoma, large-cell -1.100 1.5e-03
Multiple myeloma 1.616 1.1e-04
osteosarcoma -1.119 4.7e-05
Pneumonia -2.400 1.6e-03
Polycystic ovary syndrome 1.416 3.3e-03
psoriasis -1.500 7.2e-05
subependymal giant cell astrocytoma -2.310 2.7e-02
Waldenstrons macroglobulinemia 1.260 3.4e-03

Gene RIF (7)

AA Sequence

MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLN      1 - 70
LKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK                                  71 - 111
//

Text Mined References (27)

PMID Year Title