Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.81
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.260 0.003
Multiple myeloma 1.616 0.000
psoriasis -1.500 0.000
glioblastoma -1.900 0.001
osteosarcoma -1.119 0.000
ependymoma -1.400 0.000
medulloblastoma -1.600 0.001
astrocytoma -1.400 0.008
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -1.900 0.001
Breast cancer 2.300 0.031
adult high grade glioma -1.900 0.000
Pneumonia -2.400 0.002
subependymal giant cell astrocytoma -2.310 0.027
Polycystic Ovary Syndrome 1.416 0.003
lung carcinoma 1.200 0.000

Synonym

Accession P14927 E5RJU0 Q6FGD1
Symbols QPC
QCR7
QP-C
UQBC
UQBP
UQPC
UQCR6
MC3DN3

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
25446085 a UQCRB mutation promotes angiogenesis through the generation of mitochondrial reactive oxygen species
23708980 Mitochondrial UQCRB regulates VEGFR2 signaling in endothelial cells.
23475074 Studies indicate that mitochondrial oxygen sensor ubiquinol-cytochrome c reductase binding protein (UQCRB) as a terpestacin-binding protein.
22545919 Two SNPs in the 3' untranslated region of UQCRB (complex III), rs7836698 and rs10504961, were associated with overall survival.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLN      1 - 70
LKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK                                  71 - 111
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25446085 2014 A mutation in the mitochondrial protein UQCRB promotes angiogenesis through the generation of mitochondrial reactive oxygen species.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23708980 2013 Mitochondrial UQCRB regulates VEGFR2 signaling in endothelial cells.
23475074 2013 Exploring the role of mitochondrial UQCRB in angiogenesis using small molecules.
22545919 2012 Polymorphisms in the mitochondrial oxidative phosphorylation chain genes as prognostic markers for colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
21215626 2011 Identification of a novel small molecule targeting UQCRB of mitochondrial complex III and its anti-angiogenic activity.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...