Property Summary

NCBI Gene PubMed Count 144
Grant Count 18
R01 Count 11
Funding $1,651,199.81
PubMed Score 96.60
PubTator Score 89.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (67)

PMID Text
26545977 Idiopathic pulmonary fibrosis lung fibroblasts expressed less Pkgb protein than control fibroblasts, but characteristic fibroblast phenotypes (adhesion, proliferation, and apoptosis) were not controlled by Pkgb expression.
25925948 Expression of gamma-catenin in NSCLC cells resulted in reduced cell migration as determined by both scratch assays and trans-well cell migration assays.
25549959 Immunostaining for plakoglobin might serve as an additional diagnostic marker of arrhythmogenic right ventricular cardiomyopathy in forensic pathology.
25087486 Six variants of uncertain clinical significance in the PKP2, JUP, and DSG2 genes showed a deleterious effect on mRNA splicing, indicating these are ARVD/C-related pathogenic splice site mutations.
24914344 gamma-catenin is a tumor suppressor in esophageal squamous cell carcinoma and may serve as a prognostic marker
24457449 The combination of gamma-catenin and Twist positive staining is associated with poor prognosis in malignant pleural mesothelioma.
24441103 extranuclear plakoglobin has a role in controlling cell adhesion via p38MAPK-dependent regulation of keratin filament organization
24294380 Immunohistochemical analysis of plakoglobin had a relatively high sensitivity and specificity in arrhythmogenic right ventricular cardiomyopathy, but could not be relied upon as a diagnostic test for ARVC.
24260116 Plakoglobin represses SATB1 expression and decreases in vitro proliferation, migration and invasion.
23806441 redistribution of JUP from the cell membrane to the nucleus not only has the potential to serve as a diagnostic marker for ARVC but also might provide insights into its pathogenesis
More...

AA Sequence

MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQG      1 - 70
DLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELA     71 - 140
TRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILH    141 - 210
NLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKN    211 - 280
NPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVE    281 - 350
AGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC    351 - 420
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLN    421 - 490
QPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIV    491 - 560
EGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPL    561 - 630
MELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDAT    631 - 700
YRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA                             701 - 745
//

Text Mined References (155)

PMID Year Title
26545977 2015 Plakoglobin expression in fibroblasts and its role in idiopathic pulmonary fibrosis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25925948 2015 Novel Role for ?-Catenin in the Regulation of Cancer Cell Migration via the Induction of Hepatocyte Growth Factor Activator Inhibitor Type 1 (HAI-1).
25549959 2015 Plakoglobin: a diagnostic marker of arrhythmogenic right ventricular cardiomyopathy in forensic pathology?
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25225338 2014 Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions.
25087486 2014 Functional assessment of potential splice site variants in arrhythmogenic right ventricular dysplasia/cardiomyopathy.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
More...