Property Summary

Ligand Count 125
NCBI Gene PubMed Count 80
PubMed Score 262.48
PubTator Score 447.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 1.1e-02
posterior fossa group A ependymoma 1.300 2.2e-02
subependymal giant cell astrocytoma -2.157 3.2e-02

Synonym

Accession P14920 B2R7I5 Q16758 Q8N6R2 DAAO
Symbols DAAO
OXDA
DAMOX

Gene

DAO

PDB

2DU8   2E48   2E49   2E4A   2E82   2GNZ   3CUK   3G3E   3W4I   3W4J   3W4K   3ZNN   3ZNO   3ZNP   3ZNQ   4QFC   4QFD  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (74)

AA Sequence

MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQ      1 - 70
TFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILE     71 - 140
GKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM    141 - 210
KHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT    211 - 280
GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL       281 - 347
//

Text Mined References (83)

PMID Year Title