Property Summary

NCBI Gene PubMed Count 76
Grant Count 47
R01 Count 28
Funding $7,978,414.51
PubMed Score 256.43
PubTator Score 447.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 0.011
posterior fossa group B ependymoma 2.600 0.000
subependymal giant cell astrocytoma -2.157 0.032

Gene RIF (70)

PMID Text
26986737 The DAO gene was a susceptibility gene for schizophrenia and the genomic region between intron 1 and intron 8 may harbor functional genetic variants, which may influence the mRNA expression of DAO and neurocognitive functions in schizophrenia.
25982580 lower levels predispose to disease exacerbation after fish intake in chronic urticaria patients
24256253 In the brain, the concentration of D-serine stored in cells is defined by the activity of D-amino acid oxidase.
24237903 Data suggest that neuronal DAAO is a long-lived protein: peroxisomal fraction of DAAO is degraded via lysosomal/endosomal pathway, whereas cytosolic fraction of DAAO is ubiquitinated and targeted to proteasome pathway.
24085347 Accumulation of d-serine contributes to an ALS pathogenesis, and DAO might be a common therapeutic target for ALS.
23859606 Data suggest that acyclovir (ACV) can serve as an active site probe to study the structural basis of temperature-induced conformational changes of d-Amino acid oxidase (DAO).
23555897 The results suggest that DAO, which is involved in the N-methyl-d-aspartate receptor regulation, signaling and glutamate metabolism, is the master gene of the genetic associations and interactions underlying schizophrenia.
23497497 study suggests that NMDA receptor-mediated signalling genes, DAO, PPP3CC, DTNBP1 might be involved in schizophrenia pathogenic mechanisms related to gender
23219954 Data indicate that the protein aggregation due to the expression of the G331V d-amino acid oxidase (hDAAO) variant affects cell viability.
23152756 The DAO polymorphism rs10156191 which causes impaired metabolism of circulating histamine is associated with the clinical response in crossed-hypersensitivity to NSAIDs and could be used as a biomarker of response.
More...

AA Sequence

MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQ      1 - 70
TFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILE     71 - 140
GKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM    141 - 210
KHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT    211 - 280
GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL       281 - 347
//

Text Mined References (79)

PMID Year Title
26986737 2016 Haplotypes of the D-Amino Acid Oxidase Gene Are Significantly Associated with Schizophrenia and Its Neurocognitive Deficits.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25982580 Diamine oxidase levels in different chronic urticaria phenotypes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256253 2013 D-Serine metabolism: new insights into the modulation of D-amino acid oxidase activity.
24237903 2014 The degradation (by distinct pathways) of human D-amino acid oxidase and its interacting partner pLG72--two key proteins in D-serine catabolism in the brain.
24085347 2013 Amyotrophic lateral sclerosis: an update on recent genetic insights.
23859606 2013 The antiviral drug acyclovir is a slow-binding inhibitor of (D)-amino acid oxidase.
23555897 2013 The DAO gene is associated with schizophrenia and interacts with other genes in the Taiwan Han Chinese population.
More...