Property Summary

NCBI Gene PubMed Count 296
Grant Count 493
R01 Count 324
Funding $77,217,113.18
PubMed Score 330.06
PubTator Score 835.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
cutaneous lupus erythematosus 3.900 0.001
psoriasis 3.100 0.000
juvenile dermatomyositis 1.041 0.000
tuberculosis and treatment for 3 months -1.400 0.000
lung cancer -2.900 0.000
active Crohn's disease 2.833 0.005
sarcoidosis 1.900 0.036
interstitial cystitis 3.000 0.022
cystic fibrosis 2.000 0.000
primary Sjogren syndrome 1.200 0.007
inflammatory breast cancer 1.400 0.020
lung carcinoma -3.000 0.000
invasive ductal carcinoma 1.400 0.019
ulcerative colitis 5.000 0.000
ovarian cancer 1.400 0.016
head and neck cancer 3.600 0.026

Synonym

Accession P14902 E5RGR8 F6M9T7 Q540B4 IDO-1
Symbols IDO
INDO
IDO-1

Gene

PDB

2D0T   2D0U   4PK5   4PK6   4U72   4U74   5EK2   5EK3   5EK4   5ETW  

Gene RIF (282)

PMID Text
26647830 IDO, through GCN2 kinase activation, downregulates the levels of TCRcomplex tchain and cMyc, resulting in the suppression of Tcell proliferation and a reduction in the levels of LDHA and GLS2
26608400 high expression in nasopharyngeal carcinoma patients correlates with lower survival rates
26563749 ISG15 is elevated in viremic HIV-1 patients and is associated with high TRAIL and IDO levels.
26511909 may play role in unexplained recurrent miscarriage
26511316 The data are consistent with a common reaction mechanism for indoleamine 2,3-dioxygenase-catalyzed oxidation of tryptophan and other tryptophan analogues.
26449488 Our results imply the probability of involvement of IDO in development of tolerance process, and we presume that high IDO activity is associated with nonresponsiveness to food allergens despite allergen sensitization.
26426076 Defective TLR9-mediated activation of IDO1 induction is associated with an inhibitor-positive status.
26361229 Indoleamine 2,3-Dioxygenase Is Involved in the Inflammation Response of Corneal Epithelial Cells to Aspergillus fumigatus Infections
26285873 IDO activity was significantly greater in HIV/AIDS patients than in healthy controls.
26267811 MT has potentiating effect in TGF-beta1-induced EMT, independently of IDO. This nonimmunological effect of MT should be considered if IDO is the target to avoid immune escape in bladder cancer
More...

AA Sequence

MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHL      1 - 70
TDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPN     71 - 140
KPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKA    141 - 210
LQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQ    211 - 280
QTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIV    281 - 350
TKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG                     351 - 403
//

Text Mined References (309)

PMID Year Title
26647830 2016 Indoleamine 2,3?dioxygenase downregulates T?cell receptor complex ??chain and c?Myc, and reduces proliferation, lactate dehydrogenase levels and mitochondrial glutaminase in human T?cells.
26608400 2016 Prognostic value of indoleamine 2,3-dioxygenase activity and expression in nasopharyngeal carcinoma.
26563749 2016 ISG15 expression correlates with HIV-1 viral load and with factors regulating T cell response.
26511909 2016 Role of Indoleamine 2,3-Dioxygenase and Tryptophan 2,3-Dioxygenase in Patients with Recurrent Miscarriage.
26511316 2015 Substrate Oxidation by Indoleamine 2,3-Dioxygenase: EVIDENCE FOR A COMMON REACTION MECHANISM.
26449488 2016 Low indoleamine 2,3-dioxygenase activity in persistent food allergy in children.
26426076 2015 IDO1 suppresses inhibitor development in hemophilia A treated with factor VIII.
26361229 2015 Indoleamine 2,3-Dioxygenase Is Involved in the Inflammation Response of Corneal Epithelial Cells to Aspergillus fumigatus Infections.
26285873 2015 The kynurenine pathway activities in a sub-Saharan HIV/AIDS population.
26267811 2015 1-Methyl-D-tryptophan potentiates TGF-?-induced epithelial-mesenchymal transition in T24 human bladder cancer cells.
More...