Property Summary

Ligand Count 166
NCBI Gene PubMed Count 327
PubMed Score 421.06
PubTator Score 835.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 2.833 5.3e-03
Breast cancer 1.300 1.9e-03
cutaneous lupus erythematosus 3.900 7.1e-04
cystic fibrosis 1.500 1.4e-02
head and neck cancer 3.600 2.6e-02
interstitial cystitis 3.000 2.2e-02
invasive ductal carcinoma 1.400 1.9e-02
juvenile dermatomyositis 1.041 1.6e-05
lung cancer -2.900 2.2e-06
lung carcinoma -3.000 1.3e-11
ovarian cancer 1.400 1.6e-02
primary Sjogren syndrome 1.200 7.1e-03
psoriasis 2.000 9.6e-03
sarcoidosis 1.900 3.6e-02
tuberculosis -1.200 4.2e-03
ulcerative colitis 5.000 6.0e-09

Gene RIF (310)

AA Sequence

MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHL      1 - 70
TDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPN     71 - 140
KPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKA    141 - 210
LQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQ    211 - 280
QTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIV    281 - 350
TKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG                     351 - 403
//

Text Mined References (340)

PMID Year Title