Property Summary

NCBI Gene PubMed Count 28
PubMed Score 78.14
PubTator Score 23.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.080 1.5e-03
astrocytoma 1.300 9.2e-03
Breast cancer 2.300 3.9e-02
ependymoma 1.200 5.9e-09
glioblastoma 1.200 1.8e-03
lung cancer 1.200 3.5e-02
Multiple myeloma 1.101 1.9e-03
ovarian cancer 2.100 2.3e-06
pediatric high grade glioma 1.100 2.3e-04
sonic hedgehog group medulloblastoma 1.100 3.3e-03

Gene RIF (7)

AA Sequence

MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSR      1 - 70
AKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQ     71 - 140
KIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETL    141 - 210
INKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTH    211 - 280
RHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCE    281 - 350
ALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM    351 - 420
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTS    421 - 490
MFPRDPKRLTP                                                               491 - 501
//

Text Mined References (38)

PMID Year Title