Property Summary

NCBI Gene PubMed Count 25
PubMed Score 70.69
PubTator Score 23.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.71761448247719E-8
ovarian cancer 8492 2.28746842007097E-6
pediatric high grade glioma 2712 2.28653271714618E-4
lung cancer 4473 3.83504313213967E-4
acute quadriplegic myopathy 1157 0.00153863093233547
glioblastoma 5572 0.00175916387497967
Multiple myeloma 1328 0.00193751895790483
sonic hedgehog group medulloblastoma 1482 0.00325327531721734
astrocytoma 1493 0.00921970442150963
Breast cancer 3099 0.0393249929131534
Disease Target Count Z-score Confidence
Obesity 616 0.0 1.0
Disease Target Count Z-score Confidence
Cowpox 15 3.308 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.101 0.002
posterior fossa group A ependymoma 1.400 0.000
astrocytoma 1.300 0.009
glioblastoma 1.200 0.002
acute quadriplegic myopathy 1.080 0.002
lung cancer 1.400 0.000
Breast cancer 2.300 0.039
pediatric high grade glioma 1.100 0.000
sonic hedgehog group medulloblastoma 1.100 0.003
ovarian cancer 2.100 0.000

Synonym

Accession P14868 A8K3J2 D3DP77 Q2TNI3 Q32Q69 Q53HV4 Q53YC5 Q68CR9 Q9BW52
Symbols HBSL
aspRS

Gene

PDB

4J15  

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
25010285 Tandem affinity purification and mass spectrometry analysis identify aspartyl-tRNA synthetase (DARS), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23643384 Mutations in DARS cause hypomyelination with brain stem and spinal cord involvement and leg spasticity.
23609930 Report on the crystal structure of human cytosolic aspartyl-tRNA synthetase (DRS) at a resolution of 2.25 A.
23125841 Tandem affinity purification and mass spectrometry analysis identify aspartyl-tRNA synthetase (DARS), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22190034 Tandem affinity purification and mass spectrometry analysis identify aspartyl-tRNA synthetase (DARS), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12824064 the N-terminus shows a less-ordered structure with flexible beta-turn, suggesting that when tRNA is stretched, the dissociation rate of Asp-tRNA from aspartyl-tRNA synthetase is reduced, giving time for elongation factor 1alpha to interact with Asp-tRNA.

AA Sequence

MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSR      1 - 70
AKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQ     71 - 140
KIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETL    141 - 210
INKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTH    211 - 280
RHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCE    281 - 350
ALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM    351 - 420
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTS    421 - 490
MFPRDPKRLTP                                                               491 - 501
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23643384 2013 Mutations in DARS cause hypomyelination with brain stem and spinal cord involvement and leg spasticity.
23609930 2013 Crystal structure of human cytosolic aspartyl-tRNA synthetase, a component of multi-tRNA synthetase complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...