Property Summary

Ligand Count 165
NCBI Gene PubMed Count 121
PubMed Score 58.41
PubTator Score 97.18

Knowledge Summary

Patent (2,369)


  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Juvenile myoclonic epilepsy 21 0.0 5.0
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.845 1.9


  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -4.000 2.6e-05
astrocytic glioma -2.700 8.3e-03
Astrocytoma, Pilocytic -4.900 1.2e-10
atypical teratoid / rhabdoid tumor -4.900 1.7e-15
ependymoma -4.200 2.0e-03
glioblastoma -4.300 7.8e-12
group 3 medulloblastoma -3.700 2.4e-03
medulloblastoma, large-cell -3.200 7.5e-07
oligodendroglioma -2.300 3.0e-02
Parkinson's disease -1.400 3.8e-02
Pick disease -2.100 4.6e-02
primitive neuroectodermal tumor -4.500 2.5e-05
subependymal giant cell astrocytoma -4.341 1.1e-02

 GWAS Trait (1)

Gene RIF (109)

AA Sequence

RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ                                      421 - 456

Text Mined References (123)

PMID Year Title