Property Summary

NCBI Gene PubMed Count 60
Grant Count 40
R01 Count 26
Funding $2,840,999.91
PubMed Score 302.68
PubTator Score 59.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.700 0.006
ependymoma 1.900 0.008
oligodendroglioma 1.300 0.012
psoriasis 1.300 0.000
osteosarcoma 1.699 0.000
atypical teratoid / rhabdoid tumor -1.200 0.003
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.003
pancreatic ductal adenocarcinoma liver m... 1.447 0.001
lung cancer 1.400 0.001
adult high grade glioma -1.300 0.009
group 3 medulloblastoma 1.300 0.041

Gene RIF (35)

PMID Text
26805816 hnRNPA2B1, hnRNPD, hnRNPL , and YBX1 might play important roles in gastric cancer tumorigenesis.
26437669 hnRNP L controls inclusion of a broad spectrum of alternative cassette exons in T cells.
26051023 The study presents the structural characterization of the RNA recognition motif domains of hnRNP-L and demonstrate their function in repressing exon 4 of SLC2A2.
25982410 Data suggest that incorporation of 3(S)-methyl-beta-alanine into a short alpha-helical region of nucleic acid binding domain of hnRNP LL significantly stabilizes helix without affecting its DNA binding properties.
25902538 hnRNP K and hnRNP L may serve as A1CF-like cofactors in AID-mediated class switch recombination and somatic hypermutation
25623890 Our results reveal that hnRNP L is a new regulator for CD44 V10 exon splicing.
25354590 HnRNP C, YB-1 and hnRNP L coordinately enhance skipping of human MUSK exon 10 to generate a Wnt-insensitive MuSK isoform.
24526010 Results show that HNRNPL represses splicing when bound to intronic regions upstream of alternative exons, and in contrast, activates splicing when bound to the downstream intron.
24371310 THRIL has a role in regulating TNFalpha expression through its interaction with hnRNPL
24164894 Data show that alternative exons with weak 5' splice site sequences specifically show a strong correlation between hnRNP L binding and hnRNP L-dependent splicing regulation.
More...

AA Sequence

MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQH      1 - 70
GGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQA     71 - 140
LVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDV    141 - 210
LYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQ    211 - 280
DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVG    281 - 350
GHRRGPSRYGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPG    351 - 420
AAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQ    421 - 490
AAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLG    491 - 560
FLNHYQMKNPNGPYPYTLKLCFSTAQHAS                                             561 - 589
//

Text Mined References (76)

PMID Year Title
26805816 2016 Unraveling Molecular Differences of Gastric Cancer by Label-Free Quantitative Proteomics Analysis.
26437669 2015 Global analysis of physical and functional RNA targets of hnRNP L reveals distinct sequence and epigenetic features of repressed and enhanced exons.
26051023 2015 The Signature of the Five-Stranded vRRM Fold Defined by Functional, Structural and Computational Analysis of the hnRNP L Protein.
25982410 2015 Protein Synthesis with Ribosomes Selected for the Incorporation of ?-Amino Acids.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902538 2015 Identification of DNA cleavage- and recombination-specific hnRNP cofactors for activation-induced cytidine deaminase.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25623890 2015 hnRNP L inhibits CD44 V10 exon splicing through interacting with its upstream intron.
25354590 2014 HnRNP C, YB-1 and hnRNP L coordinately enhance skipping of human MUSK exon 10 to generate a Wnt-insensitive MuSK isoform.
More...