Property Summary

NCBI Gene PubMed Count 67
PubMed Score 318.98
PubTator Score 59.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 9.2e-03
astrocytic glioma -1.200 2.8e-02
atypical teratoid / rhabdoid tumor -1.200 2.8e-03
ependymoma -1.400 3.5e-02
glioblastoma -1.200 2.2e-04
group 3 medulloblastoma 1.300 4.1e-02
lung cancer 1.400 6.4e-04
medulloblastoma, large-cell -1.200 3.3e-03
oligodendroglioma -1.200 3.4e-02
osteosarcoma 1.699 2.3e-04
pancreatic ductal adenocarcinoma liver m... 1.447 5.5e-04
psoriasis 1.300 1.9e-08

Gene RIF (41)

AA Sequence

MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQH      1 - 70
GGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQA     71 - 140
LVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDV    141 - 210
LYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQ    211 - 280
DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVG    281 - 350
GHRRGPSRYGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPG    351 - 420
AAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQ    421 - 490
AAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLG    491 - 560
FLNHYQMKNPNGPYPYTLKLCFSTAQHAS                                             561 - 589
//

Text Mined References (84)

PMID Year Title