Property Summary

NCBI Gene PubMed Count 168
PubMed Score 143.20
PubTator Score 335.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Meningoencephalitis 13 4.331 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.200 3.0e-03
group 3 medulloblastoma 1.900 1.5e-04
malignant mesothelioma 2.200 4.4e-08
osteosarcoma -1.705 6.4e-05
primitive neuroectodermal tumor 1.100 1.0e-02

Protein-protein Interaction (3)

Gene RIF (122)

AA Sequence

MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNV      1 - 70
QSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQH     71 - 140
SASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQ    141 - 210
TPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLE    211 - 280
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWL    281 - 350
NDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK    351 - 420
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSPVLPLTSAAVT    421 - 490
NLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETSTTQTTSTPLSSPLGTS    491 - 560
QVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNPSLMAPSQFAAGGALLSLNPGTLSGALSPAL    561 - 630
MSNSTLATIQALASGGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASA    631 - 700
GNSAPVASLHATSTSAESIQNSLFTVASASGAASTTTTASKAQ                               701 - 743
//

Text Mined References (179)

PMID Year Title