Property Summary

NCBI Gene PubMed Count 148
Grant Count 166
R01 Count 111
Funding $17,070,909.08
PubMed Score 135.43
PubTator Score 335.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
astrocytic glioma 1.200 0.003
osteosarcoma -2.056 0.000
group 3 medulloblastoma 1.900 0.000
primitive neuroectodermal tumor 1.100 0.010

Synonym

Accession P14859 B1AL91 B1AL93 B4E029 J3KP77 Q5TBT7 Q6PK46 Q8NEU9 Q9BPV1
Symbols OCT1
OTF1
oct-1B

Gene

PDB

1CQT   1E3O   1GT0   1HF0   1O4X   1OCT   1POG   1POU  

Gene RIF (106)

PMID Text
27126747 OCT-1 plays a critical role in CD4 T cells through regulating gene expression during differentiation and mediating long-range chromosomal interactions. (Review)
27063953 Oct-1 is a direct link of transcription factors with the core transcriptional machinery and chromatin remodeling and, depending on other factors present in particular cell types, it can direct cell type specific regulation. (Review)
26464716 single-nucleotide polymorphisms of OCT1 have selective effects on the glycemic response to metformin
26178483 OCT1 siRNA significantly reduced the proliferation rate of SW620 and LoVo cells, inhibited the migration and invasion, and could reverse EMT in these two CRC cells, indicating that OCT1 plays a critical role in Colorectal cancer progression
25937278 levels of microRNA-451 (miR-451) are negatively regulated through the phosphorylation and inactivation of its direct transcriptional activator OCT1 by 5' AMP-activated protein kinase
25631079 These experiments suggested that some human herpesvirus 8-infected PEL cell line-specific DNA-binding factors, such as OCT-1, should be involved in the upregulation of ANGPT-1 in a sequence-dependent manner.
25510240 These results suggest that reduced OCT1 transport is an important determinant of metformin intolerance.
25301728 POU2F1 activity regulates HOXD10 and HOXD11 gene expression in head and neck squamous cell carcinoma, promoting a proliferative and invasive phenotype.
25236570 we demonstrate that the Oct-1 transcription factor, commonly considered pro-proliferative, indeed facilitates IFN-gamma induced apoptosis in 5637 bladder carcinoma cells
24753226 combination of prelamin A accumulation and stress conditions enhance the aging phenotype by dysregulating the activity of the octamer binding protein Oct-1
More...

AA Sequence

MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNV      1 - 70
QSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQH     71 - 140
SASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQ    141 - 210
TPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLE    211 - 280
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWL    281 - 350
NDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK    351 - 420
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSPVLPLTSAAVT    421 - 490
NLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETSTTQTTSTPLSSPLGTS    491 - 560
QVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNPSLMAPSQFAAGGALLSLNPGTLSGALSPAL    561 - 630
MSNSTLATIQALASGGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASA    631 - 700
GNSAPVASLHATSTSAESIQNSLFTVASASGAASTTTTASKAQ                               701 - 743
//

Text Mined References (159)

PMID Year Title
27126747 2016 Role of OCT-1 and partner proteins in T cell differentiation.
27063953 2016 Oct-1, to go or not to go? That is the PolII question.
26464716 2015 Genetic variants of OCT1 influence glycemic response to metformin in Han Chinese patients with type-2 diabetes mellitus in Shanghai.
26178483 2015 Octamer transcription factor 1 mediates epithelial-mesenchymal transition in colorectal cancer.
25937278 2015 Glucose-based regulation of miR-451/AMPK signaling depends on the OCT1 transcription factor.
25631079 2015 Mechanism of angiopoietin-1 upregulation in Kaposi's sarcoma-associated herpesvirus-infected PEL cell lines.
25510240 2015 Association of Organic Cation Transporter 1 With Intolerance to Metformin in Type 2 Diabetes: A GoDARTS Study.
25416956 2014 A proteome-scale map of the human interactome network.
25301728 2014 POU2F1 activity regulates HOXD10 and HOXD11 promoting a proliferative and invasive phenotype in head and neck cancer.
25236570 2014 An Oct-1-based, feed-forward mechanism of apoptosis inhibited by co-culture with Raji B-cells: towards a model of the cancer cell/B-cell microenvironment.
More...