Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.73
PubTator Score 12.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cytochrome-c Oxidase Deficiency 17 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.3e-05
osteosarcoma 7950 1.5e-04
Multiple myeloma 1332 1.6e-03
Waldenstrons macroglobulinemia 765 3.2e-02
Breast cancer 3578 3.8e-02
lung cancer 4740 4.2e-02

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.400 3.8e-02
lung cancer 1.400 4.2e-02
Multiple myeloma 1.999 1.6e-03
osteosarcoma -1.483 1.5e-04
ovarian cancer 2.500 1.3e-05
Waldenstrons macroglobulinemia 1.476 3.2e-02

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWV      1 - 70
TDWDEQRAEGTFPGKI                                                           71 - 86
//

Text Mined References (23)

PMID Year Title