Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
Funding $187,068.26
PubMed Score 18.57
PubTator Score 12.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.476 0.032
Multiple myeloma 1.999 0.002
osteosarcoma -1.483 0.000
lung cancer 1.400 0.042
Breast cancer 2.400 0.038
ovarian cancer 2.500 0.000

Synonym

Accession P14854 B2R5C9 Q6IBL4
Symbols COXG
COX6B
COXVIb1

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
26577226 p2 peptide from HIV-1 enhances HIV-1 acute infection by increasing intracellular ATP production via the activation of mitochondrial cytochrome c oxidase (MT-CO) involved in the respiratory chain
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
22190034 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)
19843159 Data found that subunits Cox6a, Cox6b and Cox7a assembled into pre-existing complex IV, while Cox4-1 and Cox6c subunits assembled into subcomplexes that may represent rate-limiting intermediates.
18499082 two siblings with severe infantile encephalomyopathy revealed the presence of a missense mutation in the COX6B1 gene

AA Sequence

MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWV      1 - 70
TDWDEQRAEGTFPGKI                                                           71 - 86
//

Text Mined References (23)

PMID Year Title
26577226 2015 ATP generation in a host cell in early-phase infection is increased by upregulation of cytochrome c oxidase activity via the p2 peptide from human immunodeficiency virus type 1 Gag.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24781756 2015 Mitochondrial complex IV deficiency, caused by mutated COX6B1, is associated with encephalomyopathy, hydrocephalus and cardiomyopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19843159 2009 Assembly of nuclear DNA-encoded subunits into mitochondrial complex IV, and their preferential integration into supercomplex forms in patient mitochondria.
18499082 2008 Severe infantile encephalomyopathy caused by a mutation in COX6B1, a nucleus-encoded subunit of cytochrome c oxidase.
More...