Property Summary

Ligand Count 3
NCBI Gene PubMed Count 133
PubMed Score 125.41
PubTator Score 1163.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 3.05 1.5
Asthma 385 0.0 3.0
Type 1 diabetes mellitus 109 0.0 1.4
Disease Target Count Z-score Confidence
Cancer 2499 3.266 1.6
Hypersensitivity reaction type II disease 253 3.132 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 3.7e-03
interstitial cystitis 1.900 9.0e-04
lung cancer -1.200 3.7e-03
lung carcinoma -1.300 2.5e-10
malignant mesothelioma 2.000 2.4e-05
medulloblastoma, large-cell 1.200 1.1e-04
primary Sjogren syndrome 1.400 2.0e-04

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (89)

AA Sequence

MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRW      1 - 70
NQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQV     71 - 140
VHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRV    141 - 210
KPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKC    211 - 280
NTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLS    281 - 350
SNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT    351 - 420
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPE    421 - 490
LVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV             491 - 551
//

Text Mined References (134)

PMID Year Title