Property Summary

NCBI Gene PubMed Count 128
Grant Count 51
R01 Count 25
Funding $5,825,105.38
PubMed Score 120.89
PubTator Score 1163.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
cutaneous lupus erythematosus 1.700 0.004
medulloblastoma, large-cell 1.200 0.000
lung cancer -1.800 0.002
interstitial cystitis 1.900 0.001
primary Sjogren syndrome 1.400 0.000
lung carcinoma -2.700 0.000

Gene RIF (86)

PMID Text
26203933 An association with the risk of erosion was observed for a haplotype of 2 single nucleotide polymorphisms of the IL-2RB gene in ACPA positive Rheumatoid arthritis patients.
26152718 IL2RB thr-450 phosphorylation is a positive regulator for receptor-IL-2 complex stability and activation of signaling molecules.
25352670 CD112 downregulation resulted in a reduced ability of DNAM-1 to bind to the surface of both virus-infected and gD-transfected cells.
25240755 MVA-gag induces a significant release of cytokines such as IL-2R, IL-6, IL-8, TNF-alpha, IFN-gamma, MCP-1, MIP-1alpha, MIP-1beta, and RANTES by the infected monocyte-derived dendritic cells in comparison with uninfected cells
24648606 IL-2 receptor beta chain expression is drastically diminished on T cells in ANCA-associated vasculitis.
24523387 Suggest that oxalate-induced activation of the renal IL-2Rbeta pathway may lead to a plethora of cellular changes, the most common of which is the induction of inflammation.
24200909 in anti-citrullinated protein antibody positive rheumatoid arthritis, the haplotype AC of IL-2RB was associated with a higher rate of erosions at baseline and at 1 year follow-up in comparison to other haplotypes.
24162774 MVA-gag induces a significant release of cytokines such as IL-2R, IL-6, IL-8, TNF-alpha, IFN-gamma, MCP-1, MIP-1alpha, MIP-1beta, and RANTES by the infected monocyte-derived dendritic cells in comparison with uninfected cells
24112992 MiniSTR marker D22S1045 (locus 22q12.3) is localized near the breakpoint region of the Ewing Sarcoma gene, but was found to be neutral related to EWS in a case-control study analyzing allele frequencies and linkage disequilibrium.
23972291 IL2RA and IL2RB as promising candidate genes for inflammatory bowel diseases(IBD) and suggesting a potential role of IL2R in the pathogenesis of IBD, likely involves regulatory T cells.
More...

AA Sequence

MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRW      1 - 70
NQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQV     71 - 140
VHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRV    141 - 210
KPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKC    211 - 280
NTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLS    281 - 350
SNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT    351 - 420
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPE    421 - 490
LVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV             491 - 551
//

Text Mined References (129)

PMID Year Title
26203933 One year in review: the pathogenesis of rheumatoid arthritis.
26152718 2015 Interleukin-2 Receptor ? Thr-450 Phosphorylation Is a Positive Regulator for Receptor Complex Stability and Activation of Signaling Molecules.
25416956 2014 A proteome-scale map of the human interactome network.
25352670 2014 Modulation of CD112 by the alphaherpesvirus gD protein suppresses DNAM-1-dependent NK cell-mediated lysis of infected cells.
24648606 2014 Abnormal expression pattern of the IL-2 receptor ?-chain on CD4+ T cells in ANCA-associated vasculitis.
24523387 2014 Oxalate upregulates expression of IL-2R? and activates IL-2R signaling in HK-2 cells, a line of human renal epithelial cells.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24200909 2014 Association of IL-2RA and IL-2RB genes with erosive status in early rheumatoid arthritis patients (ESPOIR and RMP cohorts).
24112992 2013 Neutrality of miniSTR D22S1045 marker by Ewing's sarcoma phenotype.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
More...