Property Summary

Ligand Count 1,834
NCBI Gene PubMed Count 2,480
PubMed Score 8811.63
PubTator Score 5939.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Aortic aneurysm 38 5.428 2.7
Brain Edema 50 5.176 2.6
periodontitis 293 4.743 2.4
Hypertension 396 4.493 2.2
Asthma 385 4.455 2.2
Brain Ischemia 110 3.372 1.7
Obesity 678 3.086 0.0355473813136347
Acute coronary syndrome 39 0.0 0.0
Angina, Stable 3 0.0 0.0
Aortic Aneurysm, Abdominal 9 0.0 0.0
Aortic Aneurysm, Thoracic 8 0.0 0.0
Aortic Diseases 6 0.0 0.0
Aortic Rupture 5 0.0 0.0
Bone neoplasms 8 0.0 0.0
Brain Injuries 65 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Calcinosis 70 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Cholestasis, Extrahepatic 25 0.0 0.0
Colitis, Ulcerative 59 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetic Neuropathies 14 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Hyperplasia 27 0.0 0.0
Infarction, Middle Cerebral Artery 33 0.0 0.0
Inflammation 120 0.0 0.0
Lead Poisoning 6 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver diseases 87 0.0 0.0
Lupus nephritis 13 0.0 0.0
Mammary Neoplasms, Experimental 154 0.0 0.0
Mandibuloacral dysplasia with type A lipodystrophy 2 0.0 0.0
Marfan Syndrome 15 0.0 0.0
Metaphyseal Anadysplasia 2 1 0.0 0.0
Morphine dependence 16 0.0 0.0
Multiple Organ Failure 8 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Neointima 5 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Oral Submucous Fibrosis 20 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Premature Birth 77 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Pulmonary Disease, Chronic Obstructive 31 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Pulmonary emphysema 48 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Retinal Diseases 55 0.0 0.0
Sepsis 24 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Stomach Ulcer 18 0.0 0.0
Substance Withdrawal Syndrome 55 0.0 0.0
astrocytoma 1146 0.0 0.0
glioblastoma 5792 0.0 0.00347902302240376
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Degenerative disc disease 35 0.0 5.0
Disease Target Count
Metaphyseal anadysplasia 2

Expression

  Differential Expression (26)

Disease log2 FC p
Obesity 1.100 3.6e-02
ulcerative colitis 3.400 2.5e-06
glioblastoma 1.300 3.5e-03
atypical teratoid / rhabdoid tumor 1.700 2.4e-02
Breast cancer 4.600 3.7e-02
breast carcinoma 1.700 1.5e-02
colon cancer 2.200 2.2e-02
cutaneous lupus erythematosus 3.800 6.9e-04
cystic fibrosis 1.700 1.3e-03
ductal carcinoma in situ 2.200 1.1e-02
ependymoma 1.100 3.0e-02
esophageal adenocarcinoma 1.300 1.9e-02
head and neck cancer and chronic obstruc... 2.000 3.3e-03
interstitial cystitis 3.700 6.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-02
invasive ductal carcinoma 2.800 4.6e-04
lung adenocarcinoma 1.100 3.0e-06
lung cancer 1.300 3.9e-04
malignant mesothelioma 1.700 1.5e-05
mucosa-associated lymphoid tissue lympho... 3.552 1.1e-02
non-small cell lung cancer 2.031 2.4e-14
pancreatic cancer 1.300 8.8e-04
primary pancreatic ductal adenocarcinoma 2.282 4.0e-04
primary Sjogren syndrome 2.300 1.4e-04
psoriasis 3.000 9.8e-04
tuberculosis -2.000 5.8e-05
See source...

PDB (25)

Gene RIF (2559)

AA Sequence

MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPA      1 - 70
LLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDA     71 - 140
FARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELW    141 - 210
SLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQD    211 - 280
GNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFP    281 - 350
FTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY    351 - 420
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPS    421 - 490
AGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKW    491 - 560
PALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGR    561 - 630
RLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYD    631 - 700
ILQCPED                                                                   701 - 707
//

Text Mined References (2485)

PMID Year Title