Property Summary

NCBI Gene PubMed Count 260
Grant Count 286
R01 Count 153
Funding $22,908,288.49
PubMed Score 362.92
PubTator Score 385.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P14778 Q587I7 IL-1R-1
Symbols P80
IL1R
IL1RA
CD121A
D2S1473
IL-1R-alpha

Gene

PDB

1G0Y   1IRA   1ITB   4DEP   4GAF  

Gene RIF (231)

PMID Text
26975823 IL1R1 SNP rs949963 is associated with the susceptibility to asthma in children from Central China and may increase the serum expression of IL1R1.
26560040 Altered expression of EP2 in patients with aspirin-exacerbated respiratory disease contributes to deficient induction of IL-1RI, reducing the capacity of IL-1beta to increase COX-2 and mPGES-1 expression, which results in low PGE2 production
26279140 The results present identification of critical regions within the TIR domain of IL-1 receptor type in humans and mice.
26098632 investigated the association between four inflammatory cytokines (CD121a, interleukin [IL]-1beta, IL-8, and IL-11) and coronary heart disease
26076982 IL-1R1 expression appears to define a tissue regulatory T cell phenotype together with the expression of CD25, glucocorticoid-induced tumor necrosis factor receptor family-related gene and CTLA-4.
25749018 This study found that the mRNA expression of IL-1R1, TNFR1, and TNFR2 was significantly higher in schizophreina
25697140 TNF-alpha (-308) GG, IL-10 (-819) TT, IL-10 (-1082) GG and IL1R (+1970) CC genotypes are found to be predominant (p=0.01, p=0.02, p=0.0001 and p=0.001, respectively) in both tuberculoid as well as lepromatous leprosy patients.
25453823 Blood monocytes from renal cell carcinoma patients displayed a tumor-promoting transcriptional profile that supported functions like angiogenesis and invasion. Induction of this protumor phenotype required an interleukin-1 receptor (IL-1R)-dependent mechanism.
25425640 SUMOylation is a novel mechanism in the regulation of beta-arrestin 2-mediated IL-1R/TRAF6 signaling
25240697 severe forms of pancreatitis are associated with increased levels of IL-6, IL-10 and IL-1ra
More...

AA Sequence

MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQ      1 - 70
ASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGL     71 - 140
VCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPIT    141 - 210
RVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYS    211 - 280
VENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIV    281 - 350
CSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG    351 - 420
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLEL    421 - 490
EKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQLLSPATKEKL    491 - 560
QREAHVPLG                                                                 561 - 569
//

Text Mined References (265)

PMID Year Title
26975823 2016 [Association between IL1R1 gene polymorphisms and childhood asthma].
26560040 2016 Low E-prostanoid 2 receptor levels and deficient induction of the IL-1?/IL-1 type I receptor/COX-2 pathway: Vicious circle in patients with aspirin-exacerbated respiratory disease.
26279140 2015 Identification of critical regions within the TIR domain of IL-1 receptor type I.
26098632 2015 Serum CD121a (Interleukin 1 Receptor, Type I): A Potential Novel Inflammatory Marker for Coronary Heart Disease.
26076982 2015 IL-1R1 is expressed on both Helios(+) and Helios(-) FoxP3(+) CD4(+) T cells in the rheumatic joint.
25749018 2015 Proinflammatory cytokines and their membrane-bound receptors are altered in the lymphocytes of schizophrenia patients.
25697140 2015 Association of TNF-?-(308(GG)), IL-10(-819(TT)), IL-10(-1082(GG)) and IL-1R1(+1970(CC)) genotypes with the susceptibility and progression of leprosy in North Indian population.
25453823 2014 Molecular profiling reveals a tumor-promoting phenotype of monocytes and macrophages in human cancer progression.
25425640 2015 SUMOylation attenuates human ?-arrestin 2 inhibition of IL-1R/TRAF6 signaling.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
More...