Property Summary

NCBI Gene PubMed Count 61
PubMed Score 167.60
PubTator Score 121.78

Knowledge Summary

Patent

No data available

Expression

Gene RIF (31)

AA Sequence

MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLANNSLQSVPPGA      1 - 70
FDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAAHGPLGRLTGYQLGSCGWQLQ     71 - 140
ASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD                                     141 - 177
//

Text Mined References (62)

PMID Year Title