Property Summary

NCBI Gene PubMed Count 61
Grant Count 39
R01 Count 24
Funding $3,620,877.99
PubMed Score 159.15
PubTator Score 121.78

Knowledge Summary

Patent

No data available

Expression

Gene RIF (31)

PMID Text
26203189 Data show that localization of the GP Ib-IX complex to the lipid domain is mediated by GP Ibbeta and GP IX transmembrane domains.
23995613 genetic association study in population in western India: Data suggest novel mutations in platelet glycoprotein Ib (GP1BA, GP1BB) and GP9 are associated with Bernard-Soulier syndrome in subjects studies; of 12 mutations identified, ten were novel.
23929303 Studies indicate that platelets from Bernard-Soulier syndrome (BSS) are defective in glycoprotein (GP)Ib-IX-V, a platelet-specific adhesion-signaling complex, composed of GPIbalpha disulfide linked to GPIbbeta, and noncovalently associated with GPIX and GPV.
23143686 GPIX increased the expression of GPIba by promoting the formation of a disulfide bond between GPIba and GPIbb in transfected CHO-K1 cells.
21908432 GPIbbeta missense mutations from Bernard-Soulier syndrome were examined for changes to GPIb-IX complex surface expression. Mutations A108P and P74R were found to maintain normal secretion/folding of GPIbbeta(E) but were unable to support GPIX surface expression
21699652 Report glycoprotein Ib/IX complex mutations found in Bernard-Soulier syndrome in Indian patients.
21529934 GPIIb/IIIa is the primary receptor set involved in platelet adhesion to adsorbed fibrinogen and serum albumin irrespective of their degree of adsorption-induced unfolding, while the GPIb-IX-V receptor complex plays an insignificant role.
21507943 GP Ibbeta/GP IX mediates the disulfide-linked GP Ibalpha localization to the GEMs, which is critical for vWf interaction at high shear
19874464 Raft association and cytoskeletal linkage of the platelet GPIb-IX-V complex are interrelated and are required for optimal receptor function, by attracting signaling proteins and membrane skeletal association allows proteins to move to new locations.
19566547 the putative convex surface of the LRR domain in GPIX is sufficient, in the context of full-length subunit, to mediate its association with GPIbbeta
More...

AA Sequence

MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLANNSLQSVPPGA      1 - 70
FDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAAHGPLGRLTGYQLGSCGWQLQ     71 - 140
ASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD                                     141 - 177
//

Text Mined References (62)

PMID Year Title
26203189 2015 The Transmembrane Domains of ? and IX Subunits Mediate the Localization of the Platelet Glycoprotein Ib-IX Complex to the Glycosphingolipid-enriched Membrane Domain.
25416956 2014 A proteome-scale map of the human interactome network.
23995613 2014 Novel genetic abnormalities in Bernard-Soulier syndrome in India.
23929303 2013 Bernard-Soulier syndrome: an update.
23143686 2012 Platelets with a W127X mutation in GPIX express sufficient residual amounts of GPIb? to support adhesion to von Willebrand factor and collagen.
21908432 2011 Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIb? and a GPIb?/GPIX chimera.
21699652 2011 Molecular basis of Bernard-Soulier syndrome in 27 patients from India.
21529934 2011 Delineating the roles of the GPIIb/IIIa and GP-Ib-IX-V platelet receptors in mediating platelet adhesion to adsorbed fibrinogen and albumin.
21507943 2011 Platelet glycoprotein Ib beta/IX mediates glycoprotein Ib alpha localization to membrane lipid domain critical for von Willebrand factor interaction at high shear.
19874464 2010 The platelet glycoprotein Ib-IX-V complex anchors lipid rafts to the membrane skeleton: implications for activation-dependent cytoskeletal translocation of signaling molecules.
More...