Property Summary

Ligand Count 14
NCBI Gene PubMed Count 165
PubMed Score 392.79
PubTator Score 438.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
Atopic dermatitis -1.100 1.8e-04
atypical teratoid / rhabdoid tumor 1.500 2.3e-06
ependymoma 1.100 7.3e-10
glioblastoma 1.100 1.8e-04
invasive ductal carcinoma 1.100 8.3e-04
lung cancer 1.300 3.9e-02
medulloblastoma, large-cell 1.400 7.9e-06
non-small cell lung cancer 1.137 1.2e-15
osteosarcoma -1.147 2.2e-03
ovarian cancer 2.200 2.7e-06
psoriasis 1.400 2.6e-05
Waldenstrons macroglobulinemia 1.176 2.7e-03

Gene RIF (158)

AA Sequence

MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELA      1 - 70
NGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNA     71 - 140
FTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGN    141 - 210
PKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVEN    211 - 280
KNVPLPEFPEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSEL    281 - 350
KSKGWVNTLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAV    351 - 420
AFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEGKTD    421 - 490
RTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPTKNEFIPTNFEILPLEKEATPYPALIKDTAMSKLW    491 - 560
FKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYGMYLS    561 - 630
VKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDEL    631 - 700
KEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQ    701 - 770
LPDRGWFVYQQRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRA    771 - 840
NGIQGLRFIIQSEKPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGE    841 - 910
IISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINL    911 - 980
SQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL                                   981 - 1019
//

Text Mined References (169)

PMID Year Title