Property Summary

NCBI Gene PubMed Count 162
Grant Count 138
R01 Count 70
Funding $14,670,881.51
PubMed Score 384.23
PubTator Score 438.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.176 0.003
psoriasis 1.500 0.000
osteosarcoma -1.147 0.002
ependymoma 1.100 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
Atopic dermatitis -1.100 0.000
non-small cell lung cancer 1.306 0.000
lung cancer 1.300 0.039
invasive ductal carcinoma 1.100 0.001
ovarian cancer 2.200 0.000

Synonym

Accession P14735 B2R721 B7ZAU2 D3DR35 Q5T5N2
Symbols INSULYSIN

Gene

IDE

PDB

3OFI   3E50   3N57   3N56   2G47   2G48   2G49   2G54   2G56   2JBU   2JG4   2WBY   2WC0   2WK3   2YPU   3CWW   3E4A   3E4Z   3H44   3HGZ   3QZ2   4DTT   4DWK   4GS8   4GSC   4GSF   4IFH   4IOF   4LTE   4M1C   4NXO   4PES   4PF7   4PF9   4PFC   4Q5Z   4QIA   4RAL   4RE9   5CJO  

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
434962 screening 1316 / 0 / 323542 Fluorescence polarization-based cell-based primary high throughput screening assay to identify inhibitors of insulin-degrading enzyme (IDE)
434984 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of insulin-degrading enzyme (IDE)
435028 screening 598 / 0 / 581 Fluorescence polarization-based cell-based high throughput confirmation assay for inhibitors of insulin-degrading enzyme (IDE)
463220 confirmatory 44 / 0 / 83 Dose Response: Fluorescence polarization-based cell-based high throughput dose response assay for inhibitors of insulin-degrading enzyme (IDE)
493087 screening 245 / 0 / 335216 Fluorescence polarization-based cell-based primary high throughput screening assay to identify activators of insulin-degrading enzyme (IDE)
493124 summary 0 / 0 / 0 Summary of probe development efforts to identify activators of insulin-degrading enzyme (IDE)
588439 confirmatory 32 / 0 / 199 Fluorescence polarization-based cell-based high throughput dose response assay to identify activators of insulin-degrading enzyme (IDE)
588681 confirmatory 18 / 0 / 213 Counterscreen for IDE activators: Fluorescence polarization-based biochemical high throughput dose response assay for activators of recombinant IDE
588711 confirmatory 9 / 0 / 23 Late stage counterscreen assay for the probe development effort to identify inhibitors of insulin-degrading enzyme (IDE): Fluorescence polarization-based biochemical dose response assay for inhibitors of recombinant IDE
588712 confirmatory 7 / 0 / 25 Late stage assay for the probe development effort to identify inhibitors of insulin-degrading enzyme (IDE): Fluorescence polarization-based cell-based dose response assay for inhibitors of IDE
More...

Gene RIF (156)

PMID Text
26186340 the mechanistic and molecular features of IDE-26S proteasome interaction in a cell experimental model, is reported.
25414272 results demonstrate that the polymorphisms rs1887922 and rs1999764 of the IDE gene are associated with late-onset Alzheimer disease susceptibility in the Xinjiang Han population
25105907 No significant associations have been found between other IDE gene single nucleotide polymorphisms of rs4646953, rs2251101 and rs1544210 with Alzheimer disease.
24516642 IDE does not play a major role in MHC class I antigen processing, confirming the dominant and almost exclusive role of the proteasome in cytosolic production of MHC class I ligands.
24477584 Our study provided evidence to IDE, PON1, WFS1, POU2F1, IL1alpha and IL1beta associated with T2D in Pakistanis.
24355596 Cognitive impairment is more frequent among those exposed to the C allele of the rs2209972 SNP of the insulin degrading enzyme gene.
24059301 using combinational in silico investigations, study identified that pathogenic nonsynonymous mutations corresponding to p.I54F, p.P122T, p.T533R, p.P581A and p.Y609A have more potential role in structural and functional deviations of IDE activity
23922390 Conformational changes in IDE, including a swinging-door mechanism that permits the entry of short peptides into the catalytic chamber, governs the selective destruction of amyloidogenic peptides.
23797320 An upstream promoter element which blocks the antisense transcription of the human IDE promoter, was identified.
23597493 Both IDE and type 2 diabetes are associated with executive function levels in older adults
More...

AA Sequence

MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELA      1 - 70
NGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNA     71 - 140
FTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGN    141 - 210
PKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVEN    211 - 280
KNVPLPEFPEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSEL    281 - 350
KSKGWVNTLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAV    351 - 420
AFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEGKTD    421 - 490
RTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPTKNEFIPTNFEILPLEKEATPYPALIKDTAMSKLW    491 - 560
FKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYGMYLS    561 - 630
VKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDEL    631 - 700
KEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQ    701 - 770
LPDRGWFVYQQRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRA    771 - 840
NGIQGLRFIIQSEKPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGE    841 - 910
IISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINL    911 - 980
SQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL                                   981 - 1019
//

Text Mined References (166)

PMID Year Title
26186340 2015 Proteasome Activity Is Affected by Fluctuations in Insulin-Degrading Enzyme Distribution.
25414272 2015 Association between polymorphisms of the insulin-degrading enzyme gene and late-onset Alzheimer disease.
25105907 2015 Association of insulin degrading enzyme gene polymorphisms with Alzheimer's disease: a meta-analysis.
24516642 2014 No major role for insulin-degrading enzyme in antigen presentation by MHC molecules.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24477584 2014 Genetic association of IDE, POU2F1, PON1, IL1? and IL1? with type 2 diabetes in Pakistani population.
24355596 2015 C allele of the rs2209972 single nucleotide polymorphism of the insulin degrading enzyme gene and Alzheimer's disease in type 2 diabetes, a case control study.
24059301 2014 Structural and functional characterization of pathogenic non- synonymous genetic mutations of human insulin-degrading enzyme by in silico methods.
23922390 2013 Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.
23797320 2013 Transcriptional directionality of the human insulin-degrading enzyme promoter.
More...