Property Summary

Ligand Count 17
NCBI Gene PubMed Count 184
PubMed Score 2021.17
PubTator Score 2933.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Solar Lentigines 6
Disease Target Count P-value
psoriasis 6694 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 1.1e-03

 CSPA Cell Line (2)

Gene RIF (127)

AA Sequence

MLLAVLYCLLWSFQTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQFP      1 - 70
FTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVRRNIFDLSAPEKDKFFAYLTL     71 - 140
AKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMHYYVSMDALLGGSEIWRDIDFAHEAPAFLPW    141 - 210
HRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLE    211 - 280
EYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASP    281 - 350
LTGIADASQSSMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPEANAPIGH    351 - 420
NRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSDPDSFQDYIKSYLEQASRIWSWLLGAAMVGAVLTA    421 - 490
LLAGLVSLLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL                                   491 - 529
//

Text Mined References (186)

PMID Year Title