Property Summary

NCBI Gene PubMed Count 69
Grant Count 98
R01 Count 30
Funding $10,718,854.41
PubMed Score 306.88
PubTator Score 107.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.301 0.014
Multiple myeloma 2.052 0.000
malignant mesothelioma 1.400 0.000
psoriasis 3.100 0.000
osteosarcoma 2.343 0.000
glioblastoma 1.700 0.005
sonic hedgehog group medulloblastoma 1.600 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 2.000 0.000
diabetes mellitus -1.800 0.002
pediatric high grade glioma 1.400 0.000
invasive ductal carcinoma 1.400 0.000
ovarian cancer 3.000 0.000
dermatomyositis 1.300 0.002

Synonym

Accession P14678 Q15490 Q6IB35 Q9UIS5 snRNP-B
Symbols COD
CCMS
SNRPB1
SmB/B'
Sm-B/B'
snRNP-B
SmB/SmB'

Gene

PDB

3JCR   3CW1   3PGW   4PJO   4WZJ   1D3B  

Gene RIF (7)

PMID Text
25504470 Cerebro-costo-mandibular syndrome is due to heterozygous mutations in SNRPB.
25047197 Mutations in the regulatory alternative exon of SNRPB disrupted it's auto-regulation and caused cerebro-costo-mandibular syndrome.
24357717 Highly mobile SmB protein-trafficking vesicles in neural cells are dependent on the cellular levels of SMN and SmB for their morphology and mobility.
20418484 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19997741 in addition to affecting coilin-coilin interaction and localization in the nucleus, the phosphorylation state of coilin also impacts its interaction with SMN and SmB' and may play a role in controlling U snRNP cycling through the Cajal bodies.
11780068 U2 snRNPs interact with the HIV-1 Tat cofactor TAT-SF1 and stimulate transcription from the HIV-1 LTR promoter
10556313 Alternative splice form with additional novel exon (2b) found in short-tailed opossum, wallaby and human.

AA Sequence

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLV      1 - 70
LLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQ     71 - 140
VMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRG    141 - 210
TPMGMPPPGMRPPPPGMRGPPPPGMRPPRP                                            211 - 240
//

Text Mined References (73)

PMID Year Title
25504470 2015 Mutations in SNRPB, encoding components of the core splicing machinery, cause cerebro-costo-mandibular syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
25047197 2014 Disrupted auto-regulation of the spliceosomal gene SNRPB causes cerebro-costo-mandibular syndrome.
24357717 2014 Time-resolved quantitative proteomics implicates the core snRNP protein SmB together with SMN in neural trafficking.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
More...