Property Summary

NCBI Gene PubMed Count 69
PubMed Score 306.88
PubTator Score 107.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.301 1.4e-02
Multiple myeloma 2.052 3.8e-05
malignant mesothelioma 1.400 1.7e-06
psoriasis 3.100 6.4e-06
osteosarcoma 2.343 1.7e-07
glioblastoma 1.700 5.3e-03
sonic hedgehog group medulloblastoma 1.600 1.4e-05
atypical teratoid/rhabdoid tumor 1.700 1.1e-07
medulloblastoma, large-cell 2.000 5.3e-06
diabetes mellitus -1.800 2.2e-03
pediatric high grade glioma 1.400 6.8e-07
invasive ductal carcinoma 1.400 3.2e-04
ovarian cancer 3.000 2.8e-06
dermatomyositis 1.300 1.6e-03

Gene RIF (7)

PMID Text
25504470 Cerebro-costo-mandibular syndrome is due to heterozygous mutations in SNRPB.
25047197 Mutations in the regulatory alternative exon of SNRPB disrupted it's auto-regulation and caused cerebro-costo-mandibular syndrome.
24357717 Highly mobile SmB protein-trafficking vesicles in neural cells are dependent on the cellular levels of SMN and SmB for their morphology and mobility.
20418484 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19997741 in addition to affecting coilin-coilin interaction and localization in the nucleus, the phosphorylation state of coilin also impacts its interaction with SMN and SmB' and may play a role in controlling U snRNP cycling through the Cajal bodies.
11780068 U2 snRNPs interact with the HIV-1 Tat cofactor TAT-SF1 and stimulate transcription from the HIV-1 LTR promoter
10556313 Alternative splice form with additional novel exon (2b) found in short-tailed opossum, wallaby and human.

AA Sequence

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLV      1 - 70
LLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQ     71 - 140
VMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRG    141 - 210
TPMGMPPPGMRPPPPGMRGPPPPGMRPPRP                                            211 - 240
//

Text Mined References (73)

PMID Year Title
25504470 2015 Mutations in SNRPB, encoding components of the core splicing machinery, cause cerebro-costo-mandibular syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
25047197 2014 Disrupted auto-regulation of the spliceosomal gene SNRPB causes cerebro-costo-mandibular syndrome.
24357717 2014 Time-resolved quantitative proteomics implicates the core snRNP protein SmB together with SMN in neural trafficking.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
20418484 2010 Common variants associated with breast cancer in genome-wide association studies are modifiers of breast cancer risk in BRCA1 and BRCA2 mutation carriers.
19997741 2010 Coilin phosphorylation mediates interaction with SMN and SmB'.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18951082 2008 Death by splicing: tumor suppressor RBM5 freezes splice-site pairing.
18495660 2008 Promiscuous modification of the nuclear poly(A)-binding protein by multiple protein-arginine methyltransferases does not affect the aggregation behavior.
18082603 2007 Purification of human telomerase complexes identifies factors involved in telomerase biogenesis and telomere length regulation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16087681 2005 Toward an assembly line for U7 snRNPs: interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes.
16000308 2005 Novel interaction partners of the CD2BP2-GYF domain.
15955813 2005 Tudor domains bind symmetrical dimethylated arginines.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15494309 2004 Coupled in vitro import of U snRNPs and SMN, the spinal muscular atrophy protein.
15231747 2004 A protein interaction framework for human mRNA degradation.
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
15105431 2004 Recognition sequences for the GYF domain reveal a possible spliceosomal function of CD2BP2.
12975319 2003 Unique Sm core structure of U7 snRNPs: assembly by a specialized SMN complex and the role of a new component, Lsm11, in histone RNA processing.
12560496 2003 The FCP1 phosphatase interacts with RNA polymerase II and with MEP50 a component of the methylosome complex involved in the assembly of snRNP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403470 2002 PSF and p54nrb bind a conserved stem in U5 snRNA.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12095920 2002 SMN, the spinal muscular atrophy protein, forms a pre-import snRNP complex with snurportin1 and importin beta.
12065586 2002 Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11780068 2001 Stimulatory effect of splicing factors on transcriptional elongation.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11756452 2002 A novel WD repeat protein component of the methylosome binds Sm proteins.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
11747828 2001 Methylation of Sm proteins by a complex containing PRMT5 and the putative U snRNP assembly factor pICln.
11720283 2001 Symmetrical dimethylation of arginine residues in spliceosomal Sm protein B/B' and the Sm-like protein LSm4, and their interaction with the SMN protein.
11714716 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins.
11713266 2001 The methylosome, a 20S complex containing JBP1 and pICln, produces dimethylarginine-modified Sm proteins.
11641277 2001 Coilin forms the bridge between Cajal bodies and SMN, the spinal muscular atrophy protein.
11574479 2001 Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein.
11549288 2001 M phase-specific association of human topoisomerase IIIbeta with chromosomes.
11522829 2001 Association of galectin-1 and galectin-3 with Gemin4 in complexes containing the SMN protein.
11343899 2001 Spliceosomal UsnRNP biogenesis, structure and function.
11226169 2001 Sm protein-Sm site RNA interactions within the inner ring of the spliceosomal snRNP core structure.
11149922 2001 A functional interaction between the survival motor neuron complex and RNA polymerase II.
10725331 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.
10601333 1999 Gemin3: A novel DEAD box protein that interacts with SMN, the spinal muscular atrophy gene product, and is a component of gems.
10556313 1999 Concerted regulation and molecular evolution of the duplicated SNRPB'/B and SNRPN loci.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.
10025403 1999 Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
9724750 1998 WW domain-mediated interactions reveal a spliceosome-associated protein that binds a third class of proline-rich motif: the proline glycine and methionine-rich motif.
9417867 1997 Multiple protein: protein interactions between the snRNP common core proteins.
9323129 1997 The spinal muscular atrophy disease gene product, SMN, and its associated protein SIP1 are in a complex with spliceosomal snRNP proteins.
8510173 1993 The cardiac form of the tissue-specific SmN protein is identical to the brain and embryonic forms of the protein.
8076607 1994 The association of the U1-specific 70K and C proteins with U1 snRNPs is mediated in part by common U snRNP proteins.
7683587 1993 Lupus autoantibodies discriminate between the highly homologous Sm polypeptides B/B' and SmN by binding an epitope restricted to B/B'.
2531083 1989 Cloned human snRNP proteins B and B' differ only in their carboxy-terminal part.
2524838 1989 Molecular cloning of cDNA encoding Sm autoantigen: derivation of a cDNA for a B polypeptide of the U series of small nuclear ribonucleoprotein particles.
2522439 1989 Cytoplasmic assembly and nuclear accumulation of mature small nuclear ribonucleoprotein particles.
2522186 1989 A comparison of snRNP-associated Sm-autoantigens: human N, rat N and human B/B'.
2174118 1990 Regulated expression of the small nuclear ribonucleoprotein particle protein SmN in embryonic stem cell differentiation.
1825643 1991 The small nuclear ribonucleoproteins, SmB and B', are products of a single gene.
1694885 1990 Epitope mapping of recombinant HeLa SmB and B' peptides obtained by the polymerase chain reaction.
1693924 1990 The closely related small nuclear ribonucleoprotein polypeptides N and B/B' are distinguishable by antibodies as well as by differences in their mRNAs and gene structures.
1376292 1992 The murine gene encoding the highly conserved Sm B protein contains a nonfunctional alternative 3' splice site.