Property Summary

NCBI Gene PubMed Count 156
Grant Count 870
R01 Count 553
Funding $67,353,283.52
PubMed Score 2066.82
PubTator Score 1100.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Synonym

Accession P14672 Q05BQ3 Q14CX2
Symbols GLUT4

Gene

Gene RIF (129)

PMID Text
26529385 SLC2A4 gene expression level was slightly lower within type 2 diabetic patients in both type of tissues. Furthermore, the negative correlation between SLC2A4 gene expression level in visceral adipose tissue and BMI has been noticed
26514725 GIV directly and constitutively binds the exocyst complex subunit Exo-70 and also associates with GLUT4-storage vesicles (GSVs) exclusively upon insulin stimulation.
26373822 A single bout of exercise elicited similar GLUT4 translocation in skeletal muscle of PCOS and Controls. The absence of impairment in GLUT4 translocation suggests that PCOS patients with obesity and insulin resistance may benefit from exercise training.
26355033 These results suggest that the initial event caused by overnutrition may be oxidative stress, which produces insulin resistance, at least in part, via carbonylation and oxidation-induced inactivation of GLUT4.
25703677 Data suggest that down-regulation of GLUT4 expression in white/beige/brown adipocytes is associated with impaired glucose uptake/metabolism, impaired adipogenesis, and insulin resistance. [REVIEW]
25306890 Leptin at concentrations used in the study does not change glucose transport into lymphocytes and seems to have no influence on the expression of GLUT1, GLUT3, GLUT4 and and leptin receptors
25084986 These results indicate that T2DM patients may have a high level miR-199a that reduce GLUT4 expression and contribute to the insulin resistance.
25025572 Role of the guanine nucleotide exchange factor in Akt2-mediated plasma membrane translocation of GLUT4 in insulin-stimulated skeletal muscle.
25004245 Therapeutic concentrations of cyclosporine and tacrolimus can inhibit glucose uptake independent of insulin signaling by removing GLUT4 from the cell surface via an increased rate of endocytosis.
24932809 Expression of GLUT1 and GLUT4 in prostate cancer cells were regulated by flavonoids.
More...

AA Sequence

MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPS      1 - 70
SIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLIL     71 - 140
GRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTV    141 - 210
LPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLG    211 - 280
SRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRR    281 - 350
TLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM    351 - 420
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLL    421 - 490
EQEVKPSTELEYLGPDEND                                                       491 - 509
//

Text Mined References (160)

PMID Year Title
26529385 2016 Single nucleotide polymorphisms in 5'-UTR of the SLC2A4 gene regulate solute carrier family 2 member 4 gene expression in visceral adipose tissue.
26514725 2015 GIV/girdin binds exocyst subunit-Exo70 and regulates exocytosis of GLUT4 storage vesicles.
26373822 2015 GLUT4 translocation is not impaired after acute exercise in skeletal muscle of women with obesity and polycystic ovary syndrome.
26355033 2015 Excessive caloric intake acutely causes oxidative stress, GLUT4 carbonylation, and insulin resistance in healthy men.
25703677 2015 Insulin resistance and impaired adipogenesis.
25306890 2015 Leptin at gender-specific concentrations does not affect glucose transport, expression of glucose transporters and leptin receptors in human lymphocytes.
25084986 2014 MiR-199a is overexpressed in plasma of type 2 diabetes patients which contributes to type 2 diabetes by targeting GLUT4.
25025572 2014 Role of the guanine nucleotide exchange factor in Akt2-mediated plasma membrane translocation of GLUT4 in insulin-stimulated skeletal muscle.
25004245 2014 Cyclosporine A and tacrolimus reduce the amount of GLUT4 at the cell surface in human adipocytes: increased endocytosis as a potential mechanism for the diabetogenic effects of immunosuppressive agents.
24932809 2014 Regulation of GLUT transporters by flavonoids in androgen-sensitive and -insensitive prostate cancer cells.
More...