Property Summary

NCBI Gene PubMed Count 156
PubMed Score 2066.82
PubTator Score 1100.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 7.2e-34

Protein-protein Interaction (7)

Gene RIF (129)

PMID Text
26529385 SLC2A4 gene expression level was slightly lower within type 2 diabetic patients in both type of tissues. Furthermore, the negative correlation between SLC2A4 gene expression level in visceral adipose tissue and BMI has been noticed
26514725 GIV directly and constitutively binds the exocyst complex subunit Exo-70 and also associates with GLUT4-storage vesicles (GSVs) exclusively upon insulin stimulation.
26373822 A single bout of exercise elicited similar GLUT4 translocation in skeletal muscle of PCOS and Controls. The absence of impairment in GLUT4 translocation suggests that PCOS patients with obesity and insulin resistance may benefit from exercise training.
26355033 These results suggest that the initial event caused by overnutrition may be oxidative stress, which produces insulin resistance, at least in part, via carbonylation and oxidation-induced inactivation of GLUT4.
25703677 Data suggest that down-regulation of GLUT4 expression in white/beige/brown adipocytes is associated with impaired glucose uptake/metabolism, impaired adipogenesis, and insulin resistance. [REVIEW]
25306890 Leptin at concentrations used in the study does not change glucose transport into lymphocytes and seems to have no influence on the expression of GLUT1, GLUT3, GLUT4 and and leptin receptors
25084986 These results indicate that T2DM patients may have a high level miR-199a that reduce GLUT4 expression and contribute to the insulin resistance.
25025572 Role of the guanine nucleotide exchange factor in Akt2-mediated plasma membrane translocation of GLUT4 in insulin-stimulated skeletal muscle.
25004245 Therapeutic concentrations of cyclosporine and tacrolimus can inhibit glucose uptake independent of insulin signaling by removing GLUT4 from the cell surface via an increased rate of endocytosis.
24932809 Expression of GLUT1 and GLUT4 in prostate cancer cells were regulated by flavonoids.
24931902 shRNA-mediated down-regulation of GLUT4 diminishes glucose uptake and induces metabolic reprogramming by reallocating metabolic flux to oxidative phosphorylation.
24656589 Study of the molecular mechanisms of GLUT4 regulation in adipocytes.
24636949 Crystal structure of Myo1c/14-3-3beta complex, which has been implicated in the exocytosis of glucose transporter 4 storage vesicles during insulin-stimulated glucose uptake.
24533495 findings suggest that the AA genotype and A allele of SLC2A4 promoter, rs5418 were associated with top-level endurance performance in the northern Han Chinese population.
24410986 GLUT4 gene SNPrs5417 is associated with obstructive sleep apnea syndrome in hypertensive population.
24402435 Inhibition of PGC-1A suppresses cell proliferation probably by downregulation of VEGF and GLUT-4.
24216110 Taken together, these results demonstrated that BCAR3 plays an important role in the signaling pathways of insulin leading to cell cycle progression and cytoskeleton reorganization, but not GLUT4 translocation.
23800880 Data suggest that 11 weeks of daily moderate- or high-intensity aerobic exercise improves insulin resistance and up-regulates glucose transport and GLUT4 in skeletal muscle (but not in white adipose tissue) of young overweight men.
23746177 it is clear that pharmacogenomics has great potential to select subjects more or less prone to regulate the SLC2A4 gene and consequently glycemic homeostasis.
23546602 Data suggest that 17 beta-estradiol enhances the the glucose uptake, activates PI3K/Akt signaling pathway, leading to translocation of glucose transporter 4 to the plasma membrane in an ERalpha-dependent manner.
23239154 Insufficient GLUT4 translocation results in decreased glucose supply in patients with critical illness myopathy.
23072821 Insulin-stimulated GLUT4 trafficking differs between t-tubules and sarcolemma; contraction-induced GLUT4 trafficking does not differ between membrane surfaces.[review]
22992739 CLASP2 directs the delivery of GLUT4 to cell cortex landing zones important for insulin action
22971162 Data from normally cycling young women suggest that expression of GLUT4 in endometrium is higher in follicular phase (as compared to luteal phase) and is localized to epithelial cells (as compared to stromal cells).
22673408 HbA1c is significantly higher in the most frequent GA haplotype compared with the second frequent AC haplotype (5.2% vs. 5.1%, P = 0.004). Genetic variations, rs5418 and rs2654185 in GLUT4 gene are associated with HbA1c level in Japanese men.
22663547 data reveal that T(3) rapidly increases glucose uptake in L6-GLUT4myc cells, which, at least for 30 minutes, did not depend on an increment in GLUT4 at the cell surface yet potentiates insulin action.
22496345 The role of CaMKII in regulating GLUT4 expression in skeletal muscle.
22488520 These data provide evidence for the existence of GLUT4 in the endocrine pancreas and indicate a physiological relevance of this glucose transporter as well as characteristic changes in diabetic disease.
22452979 Critical roles for novel GLUT family members highlight a therapeutic strategy entailing selective GLUT inhibition to specifically target aberrant glucose metabolism in cancer.
22403297 The present findings demonstrate that physical inactivity-induced insulin resistance in muscle is associated with lower content/activity of key proteins in glucose transport/phosphorylation and storage.
22384078 GLUT4 translocation and expression is induced by (+)-Rutamarin
22297303 investigation of mechanisms involved in insulin-stimulated translocation of GLUT4 from intracellular sites to sarcolemma; studies involve glucose metabolism in transgenic mice expressing a GLUT4 fusion protein (HA-GLUT4-GFP) in skeletal muscle/heart
22114711 GLUT4 protein expression is reduced in muscle from type 2 diabetic patients with severe insulin resistance.
21986508 we investigate and propose a possible link between SLC2A1 and SLC2A4 and the evolution of human brain size
21883150 The introduction of beta(2)-adrenoceptors and GLUT4 into these cells caused increased glucose uptake in response to beta-adrenoceptor agonists.
21796809 insulin resistance is observed in patients with advanced liver cirrhosis but may not be correlated with the skeletal contents of GLUT4 protein and mRNA
21757715 critical roles of the N-glycan chain in quality control as well as intracellular trafficking of GLUT4.
21668369 genetic association studies of GLUT4 in a population in India: An SNP in GLUT4 (rs5435, C/T) is associated with type 2 diabetes. ACGT haplotypes of rs5418 (A/G), rs5435 (C/T), rs5421 (C/G), and T/G variant in 3-UTR showed protection against diabetes.
21645024 Both adipose tissues have lower GLUT4 levels in patients with coronary artery disease; these findings suggest a differential regulation of RBP4 production in epicardial adipose tissue and subcutaneous adipose tissue, possibly influenced by local factors.
21606541 HIV-1 Nef inhibits GLUT4 fusion with plasma membrane in insulin-stimulated adipocytes, which leads to inhibition of glucose uptake
21604201 findings showed that adipose insulin-responsive glucose transporter type 4 (GLUT4) gene expression changes were more related to insulin resistance and type 2 diabetes rather than to obesity
21547502 Subcellular trafficking of the substrate transporters GLUT4 and CD36 in cardiomyocytes.
21468601 The knockdown of STEAP4 inhibits insulin-stimulated glucose transport and GLUT4 translocation via the attenuated phosphorylation of Akt, independent of the effects of EEA1.
21454697 Insulin-stimulated GLUT4 protein translocation in adipocytes requires the Rab10 guanine nucleotide exchange factor Dennd4C
21454690 AS160 phosphotyrosine-binding domain constructs inhibit insulin-stimulated GLUT4 vesicle fusion with the plasma membrane
21454505 Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.
21187969 the serum-induced increase in cell surface GLUT4 levels is not due to inhibition of its internalization and is not mediated by insulin, PDGF, IGF-1, or HGF
21147915 GLUT4 is greatly increased in human Cytomegalovirus infected cells.
20965718 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625434 Observational study of gene-disease association. (HuGE Navigator)
20501875 The objective of this review is to highlight how advances in recent experimental approaches translate into an enhanced understanding of the regulation of GLUT4 translocation and glucose transport in mature skeletal muscle--REVIEW
20417083 Recent work on how GLUT4 and other proteins assemble in insulin-responsive vesicles (IRVs), how these vesicles are retained intracellularly in unstimulated cells, and how they may be mobilized by insulin, is summarized.
20406953 derepression of peroxisome proliferator-activated receptor-gamma transcription by the high levels of forkhead box O1 could partially account for the lower levels of SLC2A4 found in polycystic ovary syndrome
20363751 ZAC1 is a novel and previously unknown regulator of cardiomyocyte Glut4 expression and glucose uptake; MEF2 is a regulator of ZAC1 expression in response to induction of hypertrophy
20352120 glucose transporter-4 (SLC2A4) genetic diversity in humans reflects the action of natural selection along the old-world primates evolution
20173759 Inhibition of AMP-activated protein kinase activity by ethanol leads to decreased myocyte enhancer factor 2 and GLUT4 expression in rat and human adipocytes
20103707 Etomoxir treatment reduces glut4 mRNA transcription in mouse adiose tissue.
19955252 Data show altered mRNA expression of insulin receptor substrate (IRS)-1, IRS-2, glucose transporter (GLUT)-1, GLUT-4 and glycogen synthase kinase-3 isoforms genes in adipose tissue in gestational diabetes mellitus women in comparison to pregnant controls.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19885647 elevated protein expression in peripheral blood lymphocytes of patients with type 2 diabetes mellitus
19692168 Observational study of gene-disease association. (HuGE Navigator)
19648108 Results show that 8-aminoadenosine reduces glucose consumption by regulating localization and expression of key glucose transporters GLUT1 and GLUT4.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19590752 Data conclude that Rab4b is a new important player in the control of GLUT4 trafficking in adipocyte.
19554504 The expression pattern of GLUT4 is reported in newly diagnosed esophageal adenocarcinoma by means of immunohistochemistry.
19549745 Insulin-stimulated translocation of glucose transporter (GLUT) 12 parallels that of GLUT4 in normal muscle.
19389739 Components of the insulin signalling and GLUT4 trafficking machinery may serve as potential targets for the development of orally available insulin mimics for the treatment of diabetes mellitus.
19375584 The GLUT4 protein, unlike mRNA expression, was higher in omental than in subcutaneous adipose tissue. omental and subcutaneous GLUT4 was reduced in visceral obesity.
19328476 After the action of testosterone solution, the protein expressions of IRS-1mRNA, IRS-1, and GLUT-4 in endometrial glandular epithelial cells all decreased significantly. Metformin may reverse this effect.
19321702 Report down-regulation of GLUT4 expression in denervated skeletal muscle.
19286271 Ultimate utility of monocyte GLUT-4 expression as an index of whole body insulin responsiveness is not yet resolved[REVIEW]
19251038 The role fo GLUT4 in glucose transport in response to insulin is described.
19219452 GLUT4, leveks were unchanged from the resting levels after both exercise trials in deltoid.
19188436 Insulin stimulation of the GLUT4 exocytosis rate constant is sufficient to account for most of the observed increase in glucose transport activity in rat and human muscle.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19035854 A novel GLUT4 translocation assay that is optimal for identifying negative regulators of GLUT4 translocation.
18778861 Low skeletal muscle GLUT4 contributes to insulin resistance in chronic heart failure
18769028 FXR is a new transcription factor of GLUT4, further elucidating the potential role for FXR in glucose metabolism.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18635880 GLUT4 was reduced by 28% in vastus lateralis in chronic obstructive pulmonary disease.
18299470 In hyperthyroidism: 1) basal abundance of GLUT3 and GLUT4 on the plasma membrane is increased and 2) the sensitivity of the recruitment of GLUT3 and GLUT4 transporters on the plasma membrane in response to IGF-I is increased
18249389 Observational study of gene-disease association. (HuGE Navigator)
18184930 AMP-activated protein kinase (AMPK) regulates GLUT4 transcription through the histone deacetylase (HDAC)5 transcriptional repressor.
18067156 McArdle's disease muscle had higher phosphofructokinase protein content and activity as well as glucose transporter 4 (GLUT4) protein content and lower GLUT4 mRNA content than controls
18056982 an exercise protocol designed to strain muscle carbohydrate reserves and to result in large increases in lactic acid results in a rapid upregulation of both GLUT-4 and MCT-4
17717074 Study indicated that further progress in teasing apart the GLUT4 code will require the development and application of novel and advanced technologies that can discriminate one molecule from another in the living cell.
17611657 Findings suggest that characteristic differences in the patterns of glucose uptake can exist according to the histological type and that GLUT1, GLUT3 and GLUT4 could be related to tumor angiogenesis in epithelial ovarian carcinoma.
17496362 signaling connections spanning the insulin receptor and GLUT4 [REVIEW]
17448565 Our findings implicate the muscular GLUT4 system in the glucose intolerance of liver cirrhosis by a mechanism different from that in diabetes.
17382906 enhanced GLUT4 activity was paralleled by increased transporter abundance in the plasma membrane. Disruption of the SGK1 phosphorylation site on GLUT4 ((S274A)GLUT4) abrogated the stimulating effect of SGK1.
17220298 the luminal Vps10p domain of sortilin plays the predominant role in targeting to insulin-responsive Glut4-containing vesicles
17164432 Differences in GLUT4 transcription when whole adipose tissue and cell culture model systems are compared can be correlated to a posttranslational phosphorylation of the transcription factor MEF2A.
17035674 Adipose LPIN1 gene expression associates with basal and insulin-mediated subcutaneous adipocyte glucose transport as well as mRNA levels of glucose transporter 4.
16966355 Results suggest involvement of AMP-activated protein kinase in the control of expression of both metabolic genes, UCP3 and GLUT4, in the skeletal muscle of mice and of human newborns.
16803853 GLUT4 and GLUT12 were predominantly expressed in type I oxidative fibers; however, GLUT5 was expressed predominantly in type II (white) fibers
16787385 results suggest that upregulation of GLUT4 gene transcription might be directly mediated by SREBP-1c in adipose tissue
16763099 In conclusion, exercise at approximately 40 and approximately 80% V(O2 peak), with total work equal, increased GLUT4 mRNA and GLUT4 protein in human skeletal muscle to a similar extent, despite differences in exercise intensity and duration.
16497805 Glut4 plasma membrane translocation and glucose uptake are induced by insulin and leptin in a human neuronal cell line by a phosphatidylinositol 3-kinase- dependent mechanism
16497797 GLUT4 expression is not required for adipogenic differentiation but is necessary for full lipogenic capacity of differentiated adipocytes
16213228 Our findings that AS160 knockdown only partially releases basal GLUT4 retention provides evidence that insulin signals to GLUT4 exocytosis by both AS160-dependent and -independent mechanisms.
16096283 Hyperlipidemia, exhibited as a high free fatty acid level, modulates GLUT4 gene expression in cardiac muscle via a complex mechanism including GLUT4 and the PPARgamma genes
15864539 Enhanced insulin-stimulated glycogen synthesis in human skeletal muscle cell culture coincides with increased GLUT4 mRNA expression following treatment with various antidiabetic agents.
15731326 endometrial GLUT4 expression is not affected by polycystic ovary syndrome itself, whereas it is reduced by obesity in those patients.
15528266 The insulin-regulatable GLUT4 is expressed in the cytosol of first trimester syncytiotrophoblasts compatible with a role for GLUT4 in placental glucose transport in early pregnancy.
15480742 Expression in response to exercise training in glucose intolerant elderly men.
15334390 8 weeks of exercise training increases insulin-stimulated glucose disposal primarily by increasing GLUT4 protein expression without enhancing insulin-stimulated phosphatidylinositol 3-Kinase signaling.
15292352 GLUT4 is present in endometrium of normal and polycystic ovary syndrome (PCOS)subjects. hyperinsulinism and obesity seem to have negative effect on endometrial GLUT4 expression in PCOS.
15247266 EHD1 and EHBP1, but not EHD2, are required for perinuclear localization of GLUT4 and reveal that loss of EHBP1 disrupts insulin-regulated GLUT4 recycling in cultured adipocytes.
15184360 Muscle samples were obtained before the start of cycle exercise training and 24 h after the first and seventh exercise sessions. GLUT-4 protein expression was increased after 7 days of exercise training compared to baseline.
15166000 ATPase inhibitors block translocation of GLUT4 in adipose cells by inhibiting formation of small insulin-responsive vesicles on donor intracellular membranes.
14747278 Strength training increases the muscle content of GLUT4.
14630949 GLUT4 transcription activation depends on the protein-protein interaction of GEF and MEF2A
14562105 TUG traps endocytosed GLUT4 and tethers it intracellularly, and insulin mobilizes this pool of retained GLUT4 by releasing this tether
12716734 AICAR increases glucose transport and cell-surface GLUT4 content in skeletal muscle from subjects with type 2 diabetes.
12716391 Expression in human slow-twitch muscle fibres is not correlated with intracellular triglyceride content.
12700047 The regulation of the GLUT4 gene is of special clinical interest because insulin-mediated glucose homeostasis is highly sensitive to the levels of GLUT4 protein in muscle and adipose tissue, as evidenced in this review.
12631717 Data suggest that GLUT4 is transported from the cell surface to a subdomain of the trans-Golgi network that is enriched in syntaxins 6 and 16 and that an acidic targeting motif in the C-terminal tail of GLUT4 plays an important role in this process.
12606502 upregulation of the p38 mitogen-activated protein kinase pathway might contribute to the loss of GLUT4 protein expression observed in adipose tissue from type 2 diabetic patients
12583599 Embedded in microvillous (maternal-facing) and basal (fetal-facing) membranes of syncytiotrophoblast, main placental barrier layer. (review)
12565902 Data describe the expression of peroxisome proliferator-activated receptor gamma (PPAR gamma) co-activator 1, PPAR gamma, insulin receptor substrate-1, glucose transporter isoform-4, and mitochondrial uncoupling protein-1 in adipose tissue.
12467732 an effect of acid maltase deficiency extending to various vesicle systems linked to lysosomes. The enzyme defect may also affect the homoeostasis of receptors cycling through these organelles such as glucose transporter 4.
12145475 The expression of the glucose transporter 4 was downregulated by up to 80% in the failing heart.
12079888 Observational study of gene-disease association. (HuGE Navigator)
12064911 observed differential response of individual isoforms GLUT1, GLUT3, & GLUT4 in neutrophils and granulocytes to hypoglycemia may represent a mechanism to protect the cells from the stress of glucose deprivation
11994746 Regulated transport of the glucose transporter GLUT4. A review.
11842083 The insulin-sensitive glucose transporter, GLUT4, interacts physically with Daxx

AA Sequence

MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPS      1 - 70
SIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLIL     71 - 140
GRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTV    141 - 210
LPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLG    211 - 280
SRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRR    281 - 350
TLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM    351 - 420
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLL    421 - 490
EQEVKPSTELEYLGPDEND                                                       491 - 509
//

Text Mined References (160)

PMID Year Title
26529385 2016 Single nucleotide polymorphisms in 5'-UTR of the SLC2A4 gene regulate solute carrier family 2 member 4 gene expression in visceral adipose tissue.
26514725 2015 GIV/girdin binds exocyst subunit-Exo70 and regulates exocytosis of GLUT4 storage vesicles.
26373822 2015 GLUT4 translocation is not impaired after acute exercise in skeletal muscle of women with obesity and polycystic ovary syndrome.
26355033 2015 Excessive caloric intake acutely causes oxidative stress, GLUT4 carbonylation, and insulin resistance in healthy men.
25703677 2015 Insulin resistance and impaired adipogenesis.
25306890 2015 Leptin at gender-specific concentrations does not affect glucose transport, expression of glucose transporters and leptin receptors in human lymphocytes.
25084986 2014 MiR-199a is overexpressed in plasma of type 2 diabetes patients which contributes to type 2 diabetes by targeting GLUT4.
25025572 2014 Role of the guanine nucleotide exchange factor in Akt2-mediated plasma membrane translocation of GLUT4 in insulin-stimulated skeletal muscle.
25004245 2014 Cyclosporine A and tacrolimus reduce the amount of GLUT4 at the cell surface in human adipocytes: increased endocytosis as a potential mechanism for the diabetogenic effects of immunosuppressive agents.
24932809 2014 Regulation of GLUT transporters by flavonoids in androgen-sensitive and -insensitive prostate cancer cells.
24931902 2015 Loss of GLUT4 induces metabolic reprogramming and impairs viability of breast cancer cells.
24656589 2014 Molecular mechanisms of GLUT4 regulation in adipocytes.
24636949 2014 Crystal structure of human myosin 1c--the motor in GLUT4 exocytosis: implications for Ca2+ regulation and 14-3-3 binding.
24533495 2014 A functional promoter polymorphism of SLC2A4 is associated with aerobic endurance in a Chinese population.
24410986 2014 Association of glucose transporter 4 genetic polymorphisms with obstructive sleep apnea syndrome in Han Chinese general population: a cross-section study.
24402435 2014 PGC-1? integrates glucose metabolism and angiogenesis in multiple myeloma cells by regulating VEGF and GLUT-4.
24216110 2013 Functional roles of BCAR3 in the signaling pathways of insulin leading to DNA synthesis, membrane ruffling and GLUT4 translocation.
23800880 2013 Exercise training favors increased insulin-stimulated glucose uptake in skeletal muscle in contrast to adipose tissue: a randomized study using FDG PET imaging.
23746177 2013 SLC2A4gene: a promising target for pharmacogenomics of insulin resistance.
23546602 2013 17?-estradiol activates glucose uptake via GLUT4 translocation and PI3K/Akt signaling pathway in MCF-7 cells.
23239154 2013 Critical illness myopathy and GLUT4: significance of insulin and muscle contraction.
23202124 2013 New loci associated with birth weight identify genetic links between intrauterine growth and adult height and metabolism.
23072821 2013 Insulin- and contraction-induced glucose transporter 4 traffic in muscle: insights from a novel imaging approach.
22992739 2012 Identification of a role for CLASP2 in insulin action.
22971162 2012 Insulin receptor and glucose transporters mRNA expression throughout the menstrual cycle in human endometrium: a physiological and cyclical condition of tissue insulin resistance.
22673408 2012 Association of GLUT4 gene variants with HbA1c level in Japanese men.
22663547 2012 Triiodothyronine acutely stimulates glucose transport into L6 muscle cells without increasing surface GLUT4, GLUT1, or GLUT3.
22496345 2012 The role of CaMKII in regulating GLUT4 expression in skeletal muscle.
22488520 2012 GLUT4 in the endocrine pancreas--indicating an impact in pancreatic islet cell physiology?
22452979 2012 Multiple myeloma exhibits novel dependence on GLUT4, GLUT8, and GLUT11: implications for glucose transporter-directed therapy.
22403297 2012 GLUT4 and glycogen synthase are key players in bed rest-induced insulin resistance.
22384078 2012 (+)-Rutamarin as a dual inducer of both GLUT4 translocation and expression efficiently ameliorates glucose homeostasis in insulin-resistant mice.
22297303 2012 Insulin stimulates fusion, but not tethering, of GLUT4 vesicles in skeletal muscle of HA-GLUT4-GFP transgenic mice.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22114711 2011 GLUT4 and UBC9 protein expression is reduced in muscle from type 2 diabetic patients with severe insulin resistance.
21986508 2011 A potential role for glucose transporters in the evolution of human brain size.
21883150 2012 ?(2)-Adrenoceptors increase translocation of GLUT4 via GPCR kinase sites in the receptor C-terminal tail.
21796809 2011 Effects of GLUT4 expression on insulin resistance in patients with advanced liver cirrhosis.
21757715 2011 N-glycosylation is critical for the stability and intracellular trafficking of glucose transporter GLUT4.
21668369 2011 GLUT4 gene polymorphisms and their association with type 2 diabetes in south Indians.
21645024 2012 Coronary artery disease is associated with higher epicardial retinol-binding protein 4 (RBP4) and lower glucose transporter (GLUT) 4 levels in epicardial and subcutaneous adipose tissue.
21604201 2013 Human subcutaneous adipose tissue Glut 4 mRNA expression in obesity and type 2 diabetes.
21547502 2011 Subcellular trafficking of the substrate transporters GLUT4 and CD36 in cardiomyocytes.
21468601 Knockdown of STEAP4 inhibits insulin-stimulated glucose transport and GLUT4 translocation via attenuated phosphorylation of Akt, independent of the effects of EEA1.
21454697 2011 Insulin-stimulated GLUT4 protein translocation in adipocytes requires the Rab10 guanine nucleotide exchange factor Dennd4C.
21454690 2011 AS160 phosphotyrosine-binding domain constructs inhibit insulin-stimulated GLUT4 vesicle fusion with the plasma membrane.
21454505 2011 Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.
21187969 2010 A serum factor induces insulin-independent translocation of GLUT4 to the cell surface which is maintained in insulin resistance.
21147915 2011 Human cytomegalovirus activates glucose transporter 4 expression to increase glucose uptake during infection.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625434 2010 Case-control analysis of SNPs in GLUT4, RBP4 and STRA6: association of SNPs in STRA6 with type 2 diabetes in a South Indian population.
20501875 2010 Measuring GLUT4 translocation in mature muscle fibers.
20417083 2010 Biogenesis and regulation of insulin-responsive vesicles containing GLUT4.
20406953 2010 Role of the transcriptional factors FOXO1 and PPARG on gene expression of SLC2A4 in endometrial tissue from women with polycystic ovary syndrome.
20363751 2010 Regulation of cardiomyocyte Glut4 expression by ZAC1.
20352120 2010 Diversity in the glucose transporter-4 gene (SLC2A4) in humans reflects the action of natural selection along the old-world primates evolution.
20173759 2010 Long-term ethanol exposure inhibits glucose transporter 4 expression via an AMPK-dependent pathway in adipocytes.
20103707 2010 Acute inhibition of fatty acid import inhibits GLUT4 transcription in adipose tissue, but not skeletal or cardiac muscle tissue, partly through liver X receptor (LXR) signaling.
19955252 2010 Diabetes and obesity during pregnancy alter insulin signalling and glucose transporter expression in maternal skeletal muscle and subcutaneous adipose tissue.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19885647 Cellular glucose transport and glucotransporter 4 expression as a therapeutic target: clinical and experimental studies.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19648108 2009 Targeting glucose consumption and autophagy in myeloma with the novel nucleoside analogue 8-aminoadenosine.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19590752 2009 Rab4b is a small GTPase involved in the control of the glucose transporter GLUT4 localization in adipocyte.
19554504 2009 Expression of hexokinases and glucose transporters in treated and untreated oesophageal adenocarcinoma.
19549745 2009 Insulin-stimulated translocation of glucose transporter (GLUT) 12 parallels that of GLUT4 in normal muscle.
19478182 2009 A role for the CHC22 clathrin heavy-chain isoform in human glucose metabolism.
19389739 2009 The molecular basis of insulin-stimulated glucose uptake: signalling, trafficking and potential drug targets.
19375584 2009 Glucose transporter 4 and insulin receptor substrate-1 messenger RNA expression in omental and subcutaneous adipose tissue in women.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19328476 2010 Effects of testosterone and metformin on glucose metabolism in endometrium.
19321702 2009 Regulation of GLUT4 expression in denervated skeletal muscle.
19286271 2009 Glucose Tranporter-4 expression in monocytes: a systematic review.
19251038 2009 Intracellular retention and insulin-stimulated mobilization of GLUT4 glucose transporters.
19219452 2009 Caveolin, GLUT4 and insulin receptor protein content in human arm and leg muscles.
19188436 2009 Kinetics of GLUT4 trafficking in rat and human skeletal muscle.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19035854 2009 Development of a novel GLUT4 translocation assay for identifying potential novel therapeutic targets for insulin sensitization.
18778861 2010 Reduced glucose transporter GLUT4 in skeletal muscle predicts insulin resistance in non-diabetic chronic heart failure patients independently of body composition.
18769028 2008 Farnesoid X receptor induces GLUT4 expression through FXR response element in the GLUT4 promoter.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18635880 2008 Altered metabolic and transporter characteristics of vastus lateralis in chronic obstructive pulmonary disease.
18299470 2008 IGF-I increases the recruitment of GLUT4 and GLUT3 glucose transporters on cell surface in hyperthyroidism.
18249389 2008 Polymorphism in postinsulin receptor signaling pathway is not associated with polycystic ovary syndrome.
18184930 2008 AMP-activated protein kinase regulates GLUT4 transcription by phosphorylating histone deacetylase 5.
18067156 2008 Increased PFK activity and GLUT4 protein content in McArdle's disease.
18056982 2008 Rapid upregulation of GLUT-4 and MCT-4 expression during 16 h of heavy intermittent cycle exercise.
17717074 2008 The GLUT4 code.
17611657 2007 Expression of glucose transporters in epithelial ovarian carcinoma: correlation with clinical characteristics and tumor angiogenesis.
17496362 2007 GLUT4's itinerary in health & disease.
17448565 2007 Muscle GLUT4 in cirrhosis.
17382906 2007 Role of SGK1 kinase in regulating glucose transport via glucose transporter GLUT4.
17220298 2007 The luminal Vps10p domain of sortilin plays the predominant role in targeting to insulin-responsive Glut4-containing vesicles.
17164432 2007 Hyperphosphorylation of MEF2A in primary adipocytes correlates with downregulation of human GLUT4 gene promoter activity.
17035674 2007 A role of lipin in human obesity and insulin resistance: relation to adipocyte glucose transport and GLUT4 expression.
17003346 2006 Retinol-binding protein 4 in human obesity.
16966355 2006 Expression of uncoupling protein 3 and GLUT4 gene in skeletal muscle of preterm newborns: possible control by AMP-activated protein kinase.
16803853 2006 Hexose transporter mRNAs for GLUT4, GLUT5, and GLUT12 predominate in human muscle.
16787385 2006 Regulation of GLUT4 gene expression by SREBP-1c in adipocytes.
16763099 2006 Acute exercise and GLUT4 expression in human skeletal muscle: influence of exercise intensity.
16647043 2006 Identification and characterization of p49/STRAP as a novel GLUT4-binding protein.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16497805 2006 Insulin and leptin induce Glut4 plasma membrane translocation and glucose uptake in a human neuronal cell line by a phosphatidylinositol 3-kinase- dependent mechanism.
16497797 2006 Lentiviral short hairpin ribonucleic acid-mediated knockdown of GLUT4 in 3T3-L1 adipocytes.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
16213228 2005 Full intracellular retention of GLUT4 requires AS160 Rab GTPase activating protein.
16096283 2005 Free fatty acids repress the GLUT4 gene expression in cardiac muscle via novel response elements.
15864539 2005 Enhanced insulin-stimulated glycogen synthesis in response to insulin, metformin or rosiglitazone is associated with increased mRNA expression of GLUT4 and peroxisomal proliferator activator receptor gamma co-activator 1.
15731326 2004 Obesity reduces the expression of GLUT4 in the endometrium of normoinsulinemic women affected by the polycystic ovary syndrome.
15528266 2005 Glucose transporter isoform 4 is expressed in the syncytiotrophoblast of first trimester human placenta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480742 2004 Effect of exercise training on muscle glucose transporter 4 protein and intramuscular lipid content in elderly men with impaired glucose tolerance.
15334390 2004 Exercise training increases glycogen synthase activity and GLUT4 expression but not insulin signaling in overweight nondiabetic and type 2 diabetic subjects.
15292352 2004 Evidence for the presence of glucose transporter 4 in the endometrium and its regulation in polycystic ovary syndrome patients.
15247266 2004 Role of EHD1 and EHBP1 in perinuclear sorting and insulin-regulated GLUT4 recycling in 3T3-L1 adipocytes.
15184360 2004 Effect of short-term training on GLUT-4 mRNA and protein expression in human skeletal muscle.
15182197 2004 EHD2 interacts with the insulin-responsive glucose transporter (GLUT4) in rat adipocytes and may participate in insulin-induced GLUT4 recruitment.
15166000 2004 V-type ATPase is involved in biogenesis of GLUT4 vesicles.
14747278 2004 Strength training increases insulin-mediated glucose uptake, GLUT4 content, and insulin signaling in skeletal muscle in patients with type 2 diabetes.
14630949 2003 Regulation of the human GLUT4 gene promoter: interaction between a transcriptional activator and myocyte enhancer factor 2A.
14562105 2003 Functional cloning of TUG as a regulator of GLUT4 glucose transporter trafficking.
12716734 2003 5-amino-imidazole carboxamide riboside increases glucose transport and cell-surface GLUT4 content in skeletal muscle from subjects with type 2 diabetes.
12716391 2003 GLUT4 expression in human muscle fibres is not correlated with intracellular triglyceride (TG) content. Is TG a maker or a marker of insulin resistance?
12700047 2003 Regulation of GLUT4 expression in vivo and in vitro.
12631717 2003 GLUT4 recycles via a trans-Golgi network (TGN) subdomain enriched in Syntaxins 6 and 16 but not TGN38: involvement of an acidic targeting motif.
12606502 2003 Enhanced basal activation of mitogen-activated protein kinases in adipocytes from type 2 diabetes: potential role of p38 in the downregulation of GLUT4 expression.
12583599 2002 Placental glucose transfer and fetal growth.
12565902 2003 Reduced expression of PGC-1 and insulin-signaling molecules in adipose tissue is associated with insulin resistance.
12556481 2003 SKIP negatively regulates insulin-induced GLUT4 translocation and membrane ruffle formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12467732 2003 Effect of acid maltase deficiency on the endosomal/lysosomal system and glucose transporter 4.
12145475 2002 Downregulation of metabolic gene expression in failing human heart before and after mechanical unloading.
12079888 2002 Glucose transporter 4 gene: association studies pertaining to alleles of two polymorphisms in extremely obese children and adolescents and in normal and underweight controls.
12064911 Sustained hypoglycemia affects glucose transporter expression of human blood leukocytes.
11994746 2002 Regulated transport of the glucose transporter GLUT4.
11842083 2002 The insulin-sensitive glucose transporter, GLUT4, interacts physically with Daxx. Two proteins with capacity to bind Ubc9 and conjugated to SUMO1.
11742412 2001 Insulin signalling and the regulation of glucose and lipid metabolism.
11681785 Structural analysis of the GLUT1 facilitative glucose transporter (review).
11500317 2001 GLUT-4 translocation in skeletal muscle studied with a cell-free assay: involvement of phospholipase D.
11217863 2001 Adipose-selective targeting of the GLUT4 gene impairs insulin action in muscle and liver.
11003568 2000 Mechanism and regulation of GLUT-4 vesicle fusion in muscle and fat cells.
10606624 1999 Cardiac hypertrophy with preserved contractile function after selective deletion of GLUT4 from the heart.
10068455 1999 Cloning of an L-3-hydroxyacyl-CoA dehydrogenase that interacts with the GLUT4 C-terminus.
9388492 1997 A myosin-derived peptide C109 binds to GLUT4-vesicles and inhibits the insulin-induced glucose transport stimulation and GLUT4 recruitment in rat adipocytes.
8457197 1993 Kinetic analysis of the liver-type (GLUT2) and brain-type (GLUT3) glucose transporters in Xenopus oocytes: substrate specificities and effects of transport inhibitors.
8300557 1994 A Leu-Leu sequence is essential for COOH-terminal targeting signal of GLUT4 glucose transporter in fibroblasts.
7916714 1993 Identification of the 5' end of the gene encoding a human insulin-responsive glucose transporter.
2656669 1989 Cloning and characterization of the major insulin-responsive glucose transporter expressed in human skeletal muscle and other insulin-responsive tissues.
2649253 1989 Identification of a novel gene encoding an insulin-responsive glucose transporter protein.
2568955 1989 Polymorphic human insulin-responsive glucose-transporter gene on chromosome 17p13.
1918382 1991 Analysis of the gene sequences of the insulin receptor and the insulin-sensitive glucose transporter (GLUT-4) in patients with common-type non-insulin-dependent diabetes mellitus.
1756912 1991 Molecular scanning of insulin-responsive glucose transporter (GLUT4) gene in NIDDM subjects.
1601840 1992 Expression and regulation of the human GLUT4/muscle-fat facilitative glucose transporter gene in transgenic mice.
1521731 1992 Insulin receptor and insulin-responsive glucose transporter (GLUT 4) mutations and polymorphisms in a Welsh type 2 (non-insulin-dependent) diabetic population.
1397719 1992 Human GLUT4/muscle-fat glucose-transporter gene. Characterization and genetic variation.