Property Summary

NCBI Gene PubMed Count 34
PubMed Score 107.74
PubTator Score 42.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.054 2.2e-03

 GO Component (1)

Gene RIF (13)

AA Sequence

MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPS      1 - 70
TLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQ     71 - 140
HPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF    141 - 210
TTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAA    211 - 280
GDASDQSTCTSPEASPSSVTS                                                     281 - 301
//

Text Mined References (36)

PMID Year Title