Property Summary

NCBI Gene PubMed Count 31
Grant Count 11
R01 Count 4
Funding $1,359,485.02
PubMed Score 106.36
PubTator Score 42.45

Knowledge Summary

Patent

No data available

Gene RIF (11)

PMID Text
26565624 HOXB1 functions as a tumor suppressor, regulated by miR-3175 in glioma.
22770981 The resulting phenotype includes bilateral facial palsy, hearing loss, and strabismus and correlates extensively with the previously reported Hoxb1(-/-) mouse phenotype.
21980499 HOXA1 A218G and HOXB1 nINS/INS variants may not contribute significantly to autism spectrum disorders risk
21433221 Hoxb1 Expression Induces Cell Fate Changes in the Trunk Neural Tube.
20678259 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20371328 analysis of a tethered-hopping model for protein-DNA binding and unbinding based on Sox2-Oct1-Hoxb1 ternary complex simulations
19477923 Data show that inducible Hox genes are selectively sensitive to the inhibition of actin polymerization and that actin polymerization is required for the assembly of a transcription complex on the regulatory region of the Hox genes.
17713478 UTX directly binds to the HOXB1 locus and is required for its activation
17167333 Variation not associated with autism in an Indian population.
11840501 It is unlikely that HoxB1 plays a significant role in the genetic predisposition to autism.
More...

AA Sequence

MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPS      1 - 70
TLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQ     71 - 140
HPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF    141 - 210
TTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAA    211 - 280
GDASDQSTCTSPEASPSSVTS                                                     281 - 301
//

Text Mined References (33)

PMID Year Title
26565624 2015 HOXB1 Is a Tumor Suppressor Gene Regulated by miR-3175 in Glioma.
22770981 2012 HOXB1 founder mutation in humans recapitulates the phenotype of Hoxb1-/- mice.
21980499 2011 An integrated meta-analysis of two variants in HOXA1/HOXB1 and their effect on the risk of autism spectrum disorders.
21433221 2011 Anterior Hox genes interact with components of the neural crest specification network to induce neural crest fates.
20678259 2010 Candidate gene study of HOXB1 in autism spectrum disorder.
20371328 2010 Tethered-hopping model for protein-DNA binding and unbinding based on Sox2-Oct1-Hoxb1 ternary complex simulations.
20195514 2010 Genome-wide association study reveals multiple loci associated with primary tooth development during infancy.
19477923 2009 Induction of HoxB transcription by retinoic acid requires actin polymerization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17713478 2007 UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.
More...