Property Summary

NCBI Gene PubMed Count 30
Grant Count 8
R01 Count 7
Funding $683,869.87
PubMed Score 38.28
PubTator Score 31.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26482852 HOXB2 and HOXB3 act as tumor suppressors in acute myeloid leukemia patients carrying the FLT3 protein mutations.
25743797 Increased expression of HOXB2 protein is associated with HPV infection and cervical cancer progression.
21672623 HOXB2 acts as a negative tumor growth regulator, decreasing proliferation in mammary adenocarcinoma tumors.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20625746 Downregulation of HoxB2, HoxB4 and Alx4 expression during the narrow window of early embryogenesis may cause omphalocele in the Cd chick model by interfering with molecular signaling required for proper VBW formation.
20195514 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20030938 hoxb2 and hoxb4 expression is related to erythroid hematopoiesis, and hoxb4 has greater relevance to erythroid hematopoiesis as compared with hoxb2.
19477923 Data show that inducible Hox genes are selectively sensitive to the inhibition of actin polymerization and that actin polymerization is required for the assembly of a transcription complex on the regulatory region of the Hox genes.
17805056 HOXB2 up-regulated lesions to have much higher HOXB2 expression than the corresponding normal tissue.
12802276 Hoxb2 is a direct target for regulation by PLZF in the developing CNS and suggest that deregulation of Hox gene expression may contribute to APL pathogenesis.

AA Sequence

MNFEFEREIGFINSQPSLAECLTSFPAVLETFQTSSIKESTLIPPPPPFEQTFPSLQPGASTLQRPRSQK      1 - 70
RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGG     71 - 140
GGARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPDG    141 - 210
EPACPGALEDICDPAEEPAASPGGPSASRAAWEACCHPPEVVPGALSADPRPLAVRLEGAGASSPGCALR    211 - 280
GAGGLEPGPLPEDVFSGRQDSPFLPDLNFFAADSCLQLSGGLSPSLQGSLDSPVPFSEEELDFFTSTLCA    281 - 350
IDLQFP                                                                    351 - 356
//

Text Mined References (31)

PMID Year Title
26482852 2015 The role of HOXB2 and HOXB3 in acute myeloid leukemia.
25743797 2015 Increased expression of HOXB2 and HOXB13 proteins is associated with HPV infection and cervical cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21672623 2011 A functional in vivo screen for regulators of tumor progression identifies HOXB2 as a regulator of tumor growth in breast cancer.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20625746 2010 HoxB2, HoxB4 and Alx4 genes are downregulated in the cadmium-induced omphalocele in the chick model.
20195514 2010 Genome-wide association study reveals multiple loci associated with primary tooth development during infancy.
20030938 2009 [Effect of ATRA on the expression of genes Hoxb2 and Hoxb4 in cord blood erythroid progenitors].
19477923 2009 Induction of HoxB transcription by retinoic acid requires actin polymerization.
17805056 2007 HOXB2 as a novel prognostic indicator for stage I lung adenocarcinomas.
More...