Property Summary

NCBI Gene PubMed Count 29
PubMed Score 41.93
PubTator Score 24.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (12)

AA Sequence

MQKATYYDNAAAALFGGYSSYPGSNGFGFDVPPQPPFQAATHLEGDYQRSACSLQSLGNAAPHAKSKELN      1 - 70
GSCMRPGLAPEPLSAPPGSPPPSAAPTSATSNSSNGGGPSKSGPPKCGPGTNSTLTKQIFPWMKESRQTS     71 - 140
KLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFN    141 - 210
RYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALH    211 - 280
SMTPSYESPSPPAFGKAHQNAYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSP    281 - 350
VYVGGGGYADPLPPPAGPSLYGLNHLSHHPSGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQG    351 - 420
RIQEAPKLTHL                                                               421 - 431
//

Text Mined References (30)

PMID Year Title