Property Summary

NCBI Gene PubMed Count 27
Grant Count 5
Funding $117,917.44
PubMed Score 41.24
PubTator Score 24.09

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26482852 HOXB2 and HOXB3 act as tumor suppressors in acute myeloid leukemia patients carrying the FLT3 protein mutations.
25996682 decreased methylation at HOXB3 and HOXB4 was associated with increased gene expression of both HOXB genes specific to the mid-risk AML, while increased DNA methylation at DCC distinctive to the high-risk AML was associated with increased gene expression
24127533 describe familial cases of TH in two generations (proband and his father), in addition to other two sporadic cases. We have found polymorphisms in the HOXB3, HOXD3, and a new synonymous variant, and PITX2 genes
23219899 HoxB3 promote prostate cancer progression by upregulating CDCA3 expression.
19854132 RASSF1A silencing strongly correlates with overexpression of HOXB3 and DNMT3B.
19477923 Data show that inducible Hox genes are selectively sensitive to the inhibition of actin polymerization and that actin polymerization is required for the assembly of a transcription complex on the regulatory region of the Hox genes.
19460752 Knockdown of homeobox B3 (HOXB3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17972163 HOXA7, HOXB3, HOXA3, and HOXB13 expression levels changed during angiogenesis, sugessting these proteins might be involved in the angiogenesis of hMSCs.
15674412 The HOXb3 was only weakly expressed in the inv(7) positive patients.
14966272 Data report novel nucleoporin 98 fusions with homeobox (HOX)A10, HOXB3 and HOXB4, and describe the results of coexpression of these proteins with the Hox cofactor Meis1 in leukemic induction.

AA Sequence

MQKATYYDNAAAALFGGYSSYPGSNGFGFDVPPQPPFQAATHLEGDYQRSACSLQSLGNAAPHAKSKELN      1 - 70
GSCMRPGLAPEPLSAPPGSPPPSAAPTSATSNSSNGGGPSKSGPPKCGPGTNSTLTKQIFPWMKESRQTS     71 - 140
KLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFN    141 - 210
RYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALH    211 - 280
SMTPSYESPSPPAFGKAHQNAYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSP    281 - 350
VYVGGGGYADPLPPPAGPSLYGLNHLSHHPSGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQG    351 - 420
RIQEAPKLTHL                                                               421 - 431
//

Text Mined References (28)

PMID Year Title
26482852 2015 The role of HOXB2 and HOXB3 in acute myeloid leukemia.
25996682 2015 Identification of differentially methylated markers among cytogenetic risk groups of acute myeloid leukemia.
24127533 2014 The absence of mutations in homeobox candidate genes HOXA3, HOXB3, HOXD3 and PITX2 in familial and sporadic thyroid hemiagenesis.
23219899 2013 HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.
22484627 2012 A genome-wide association meta-analysis identifies new childhood obesity loci.
19854132 2009 Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.
19477923 2009 Induction of HoxB transcription by retinoic acid requires actin polymerization.
17972163 2009 HOX gene analysis of endothelial cell differentiation in human bone marrow-derived mesenchymal stem cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...